PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00010638_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 156aa    MW: 18372.1 Da    PI: 9.8598
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00010638_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.22.8e-48121383128
                               NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                       pGfrFhPt+eel+ +yLk  v gk+l++ ++i+ ++iy+++PwdLp   k +e+ewyfF++rd+k+ +g r+nr+t+
  FANhyb_icon00010638_a.1.g00001.1  12 PGFRFHPTEEELLEFYLKSVVFGKRLRF-DIIEFLNIYRHDPWDLPGLSKIGEREWYFFVPRDRKHGSGGRPNRTTE 87 
                                       9*************************99.99***************8778899************************ PP

                               NAM  80 sgyWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                       +g+Wkatg+d++++s    ++ +gl+ktLvfykgrap+g+ktdWvm+eyrl
  FANhyb_icon00010638_a.1.g00001.1  88 TGFWKATGSDRKIVSLsdPKRIIGLRKTLVFYKGRAPRGTKTDWVMNEYRL 138
                                       *************997666778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100550.88810156IPR003441NAC domain
SuperFamilySSF1019411.23E-5311141IPR003441NAC domain
PfamPF023651.9E-2512138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MASEMTPELE LPGFRFHPTE EELLEFYLKS VVFGKRLRFD IIEFLNIYRH DPWDLPGLSK  60
IGEREWYFFV PRDRKHGSGG RPNRTTETGF WKATGSDRKI VSLSDPKRII GLRKTLVFYK  120
GRAPRGTKTD WVMNEYRLPD HCKLLKVDFD ASQFSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4711383140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290041.11e-105PREDICTED: NAC transcription factor 29
SwissprotQ10S659e-80NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A2P6S9T91e-104A0A2P6S9T9_ROSCH; Putative transcription factor NAM family
STRINGXP_004290041.11e-105(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62143251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.12e-85NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]