PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00008008_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 51aa    MW: 5854.92 Da    PI: 9.3719
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00008008_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26070.33.9e-22551147
                            DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47
                                      +CaaCk+lr++C++dC++apyfp+++p++f+nvh+++Ga+nv  +lk
  FANhyb_icon00008008_a.1.g00001.1  5 RCAACKYLRKACPEDCIFAPYFPSNNPQRFENVHRIYGAKNVATMLK 51
                                      6******************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.248451IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-20551IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 51 aa     Download sequence    Send to blast
MVMGRCAACK YLRKACPEDC IFAPYFPSNN PQRFENVHRI YGAKNVATML K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-156501256LOB family transfactor Ramosa2.1
5ly0_B3e-156501256LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309226.12e-32PREDICTED: LOB domain-containing protein 24-like
SwissprotP594672e-20LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594682e-20LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A2P6SMZ92e-24A0A2P6SMZ9_ROSCH; Putative transcription factor AS2-LOB family
STRINGXP_004309226.19e-32(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.18e-23LOB domain-containing protein 23