PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00007937_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 60aa    MW: 6976.08 Da    PI: 4.057
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00007937_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.12.6e-171460148
                               NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                                      lppGfrF Ptdeel+v+yL++kv+g +++l ++i+e+d+yk++Pw Lp
  FANhyb_icon00007937_a.1.g00001.1 14 LPPGFRFYPTDEELLVQYLCRKVAGYQFNL-QIIAEIDLYKFDPWVLP 60
                                      79****************************.89************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-18960IPR003441NAC domain
PROSITE profilePS5100520.8211460IPR003441NAC domain
PfamPF023653.1E-71557IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MGVPETDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGYQ FNLQIIAEID LYKFDPWVLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-34160463NO APICAL MERISTEM PROTEIN
1ut4_B5e-34160463NO APICAL MERISTEM PROTEIN
1ut7_A5e-34160463NO APICAL MERISTEM PROTEIN
1ut7_B5e-34160463NO APICAL MERISTEM PROTEIN
4dul_A5e-34160463NAC domain-containing protein 19
4dul_B5e-34160463NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by jasmonic acid. Not induced by cold treatment. {ECO:0000269|PubMed:12646039, ECO:0000269|PubMed:15319476}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008345087.22e-37LOW QUALITY PROTEIN: NAC domain-containing protein 72-like
SwissprotQ9C9327e-35NAC19_ARATH; NAC domain-containing protein 19
TrEMBLS5RDS78e-37S5RDS7_MALHU; NAC domain protein
STRINGXP_008345087.14e-37(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52890.13e-37NAC domain containing protein 19
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Zheng XY, et al.
    Coronatine promotes Pseudomonas syringae virulence in plants by activating a signaling cascade that inhibits salicylic acid accumulation.
    Cell Host Microbe, 2012. 11(6): p. 587-96
    [PMID:22704619]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Guan Q,Yue X,Zeng H,Zhu J
    The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis.
    Plant Cell, 2014. 26(1): p. 438-53
    [PMID:24415771]
  5. Chen F, et al.
    Arabidopsis Phytochrome A Directly Targets Numerous Promoters for Individualized Modulation of Genes in a Wide Range of Pathways.
    Plant Cell, 2014. 26(5): p. 1949-1966
    [PMID:24794133]
  6. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  7. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  8. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  9. Gimenez-Ibanez S, et al.
    JAZ2 controls stomata dynamics during bacterial invasion.
    New Phytol., 2017. 213(3): p. 1378-1392
    [PMID:28005270]
  10. Ueda M, et al.
    The Distinct Roles of Class I and II RPD3-Like Histone Deacetylases in Salinity Stress Response.
    Plant Physiol., 2017. 175(4): p. 1760-1773
    [PMID:29018096]
  11. Kang M, et al.
    The C-Domain of the NAC Transcription Factor ANAC019 Is Necessary for pH-Tuned DNA Binding through a Histidine Switch in the N-Domain.
    Cell Rep, 2018. 22(5): p. 1141-1150
    [PMID:29386103]
  12. Sukiran NL,Ma JC,Ma H,Su Z
    ANAC019 is required for recovery of reproductive development under drought stress in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 161-174
    [PMID:30604322]