PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00003954_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 162aa    MW: 18477.7 Da    PI: 9.824
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00003954_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.22.1e-4681383128
                               NAM   3 pGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrk 74 
                                        GfrF Pt+eelv++yL +k+e+k+  ++ +vi+++diy++ePwdLp+     +++++++w+fF++r++++a+g r+
  FANhyb_icon00003954_a.1.g00001.1   8 TGFRFYPTEEELVSFYLLNKLESKRqGSIRRVIPDLDIYSTEPWDLPRyaaeLCRGDTEQWFFFTPRQQREAQGGRP 84 
                                       7*********************9995566678***************534543344777****************** PP

                               NAM  75 nratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                       nr+t+sgyWkatg+   v+s++++++g+kkt+vfykg+ap+g++t+W m+eyr+
  FANhyb_icon00003954_a.1.g00001.1  85 NRTTASGYWKATGSPGYVYSSDNRVIGVKKTMVFYKGKAPTGRRTKWKMNEYRA 138
                                       ****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-485144IPR003441NAC domain
PROSITE profilePS5100545.1276162IPR003441NAC domain
PfamPF023652.2E-248137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MDHQEPTTGF RFYPTEEELV SFYLLNKLES KRQGSIRRVI PDLDIYSTEP WDLPRYAAEL  60
CRGDTEQWFF FTPRQQREAQ GGRPNRTTAS GYWKATGSPG YVYSSDNRVI GVKKTMVFYK  120
GKAPTGRRTK WKMNEYRAIE GAAADPSVAT TSNSATTTTI PK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-33913718139Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291581.21e-106PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR32e-68NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A2P6QE628e-99A0A2P6QE62_ROSCH; Putative transcription factor NAM family
STRINGXP_004291581.11e-106(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.14e-70NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]