PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00003337_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 276aa    MW: 30623.5 Da    PI: 9.665
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00003337_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM77.33.5e-2416167128
                               NAM  67 kyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                       ky++g+r+nr++ sgyWkatg+dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  FANhyb_icon00003337_a.1.g00001.1   1 KYPNGSRPNRVAGSGYWKATGTDKVITT-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 61 
                                       799***********************99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-33184IPR003441NAC domain
PROSITE profilePS5100535.206184IPR003441NAC domain
PfamPF023652.4E-10861IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
KYPNGSRPNR VAGSGYWKAT GTDKVITTEG RKVGIKKALV FYVGKAPKGT KTNWIMHEYR  60
LIEPSRKNGS SKLDEWVLCR IYKKSSSSSA IQKPMMVSNV PSKEQSCNGS SSECSSQLDN  120
VLEWLPEIED RFFTLPRINS LKALPQQQED TKLNLQNLGN LGSGNFDWAS LAGLNTVPEV  180
PPNTQTQAQA QINYNNDAYV PSIPPLCHVE SPPERMRRQA QEEVQSGLRT QRVENSGLFQ  240
QNSSMFTQSM CTPIDTYGLG SRFGMTGRGF SFGSGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5318882169NO APICAL MERISTEM PROTEIN
1ut4_B2e-5318882169NO APICAL MERISTEM PROTEIN
1ut7_A2e-5318882169NO APICAL MERISTEM PROTEIN
1ut7_B2e-5318882169NO APICAL MERISTEM PROTEIN
3swm_A2e-5318885172NAC domain-containing protein 19
3swm_B2e-5318885172NAC domain-containing protein 19
3swm_C2e-5318885172NAC domain-containing protein 19
3swm_D2e-5318885172NAC domain-containing protein 19
3swp_A2e-5318885172NAC domain-containing protein 19
3swp_B2e-5318885172NAC domain-containing protein 19
3swp_C2e-5318885172NAC domain-containing protein 19
3swp_D2e-5318885172NAC domain-containing protein 19
4dul_A2e-5318882169NAC domain-containing protein 19
4dul_B2e-5318882169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291667.10.0PREDICTED: NAC domain-containing protein 72-like
SwissprotQ9SQL04e-83JA2_SOLLC; NAC domain-containing protein JA2
TrEMBLA0A2P6QB411e-173A0A2P6QB41_ROSCH; Putative transcription factor NAM family
STRINGXP_004291667.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.23e-68NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]