PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00001173_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 291aa    MW: 32821.3 Da    PI: 6.5025
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00001173_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.54.1e-4771342129
                               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknr 76 
                                       ppGfrF+Ptd elv++yLk+kv +k++++ +vi++vdiyk+ PwdLp k + + ++ +wyfF++r+ kyatg r nr
  FANhyb_icon00001173_a.1.g00001.1   7 PPGFRFSPTDVELVKYYLKRKVMAKRVRV-QVIADVDIYKYAPWDLPdKsCWRYGDLKWYFFCPREMKYATGARVNR 82 
                                       9***************************9.99**************96446666888******************** PP

                               NAM  77 atksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                       at +g+Wk +gkd++v   +g++vg  ktLvf+ gr p+ge+tdWv+heyrle
  FANhyb_icon00001173_a.1.g00001.1  83 ATGAGFWKMSGKDRSVNY-NGQVVGWIKTLVFHIGRPPRGERTDWVLHEYRLE 134
                                       *****************9.99******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-574156IPR003441NAC domain
PROSITE profilePS5100553.1936156IPR003441NAC domain
PfamPF023651.3E-247133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGKAAFPPGF RFSPTDVELV KYYLKRKVMA KRVRVQVIAD VDIYKYAPWD LPDKSCWRYG  60
DLKWYFFCPR EMKYATGARV NRATGAGFWK MSGKDRSVNY NGQVVGWIKT LVFHIGRPPR  120
GERTDWVLHE YRLEDKDLAD MGVPQESYVL CVIFQKEGAG PKLSAQYGAP FKEEDWTDDE  180
VEICLDTVPH ANRPELDLVL PRGYNSPGPS STDSPEGMWI GPSSESCISD AVPHSCNVFH  240
SVSSNSATME KHCVSANGDI LSMLDCFAEE STFPINGNDK NKVCRALFPF C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-46116215174NAC domain-containing protein 19
3swm_B3e-46116215174NAC domain-containing protein 19
3swm_C3e-46116215174NAC domain-containing protein 19
3swm_D3e-46116215174NAC domain-containing protein 19
3swp_A3e-46116215174NAC domain-containing protein 19
3swp_B3e-46116215174NAC domain-containing protein 19
3swp_C3e-46116215174NAC domain-containing protein 19
3swp_D3e-46116215174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290500.10.0PREDICTED: NAC domain-containing protein 78-like
RefseqXP_011458484.10.0PREDICTED: NAC domain-containing protein 78-like
RefseqXP_011458485.10.0PREDICTED: NAC domain-containing protein 78-like
RefseqXP_011458486.10.0PREDICTED: NAC domain-containing protein 78-like
SwissprotQ9FY822e-93NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A2P6PRT41e-171A0A2P6PRT4_ROSCH; Putative transcription factor NAM family
STRINGXP_004290500.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.49e-96NAC domain containing protein 82
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]