PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00000825_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 368aa    MW: 41557.9 Da    PI: 9.1969
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00000825_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM50.28.7e-16177353109
                               NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfy 109
                                        +e+ wyfFs+r++ky++g+r+nr++++gyWkatg+  +++ ++ge++g kk+L + 
  FANhyb_icon00000825_a.1.g00001.1  17 IREDGWYFFSTRERKYQNGSRPNRKADDGYWKATGSGIDIKGENGEVIGHKKVLDYK 73 
                                       36789*************************************************986 PP

2NAM52.22e-167313665128
                               NAM  65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                       ++ky++g+r+nr++++gyWkatg+  +++ ++ge++g kk+L + kg +p   ktdW m ey+l
  FANhyb_icon00000825_a.1.g00001.1  73 KRKYQNGRRPNRKADDGYWKATGSGIDIKGENGEVIGHKKVLDYKKGAHPLNIKTDWKMLEYKL 136
                                       689***********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100521.5951167IPR003441NAC domain
SuperFamilySSF1019417.59E-171673IPR003441NAC domain
PfamPF023653.3E-52075IPR003441NAC domain
SuperFamilySSF1019411.7E-2073166IPR003441NAC domain
PfamPF023652.5E-582136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
SDRTFNLYFA SEKFKKIRED GWYFFSTRER KYQNGSRPNR KADDGYWKAT GSGIDIKGEN  60
GEVIGHKKVL DYKRKYQNGR RPNRKADDGY WKATGSGIDI KGENGEVIGH KKVLDYKKGA  120
HPLNIKTDWK MLEYKLKDEN EDNPLPKRKK GKGNMKLDLV LCKVYLNTRA NGNTNNNGAI  180
TTEISDQEMV TDSGTSHYRE TVLKQEADQV QPLDSSLMSS LQRQVHSNTT GAFNHMDHIS  240
TSSTIPETCF HSSNPMNNGV MVTDTVTSHR RHNNLVPKQE AGQVAPLDSS LVYSPQPQVH  300
NNTTGGFNHL NHISNSSSST SMSNGVYDST NCTHYGELMH NGSSGSVYQW GSSFTQLHHQ  360
NYYMYPEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-137416581163NO APICAL MERISTEM PROTEIN
1ut4_B4e-137416581163NO APICAL MERISTEM PROTEIN
1ut7_A4e-137416581163NO APICAL MERISTEM PROTEIN
1ut7_B4e-137416581163NO APICAL MERISTEM PROTEIN
4dul_A4e-137416581163NAC domain-containing protein 19
4dul_B4e-137416581163NAC domain-containing protein 19
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011467999.10.0PREDICTED: NAC domain-containing protein 19-like
TrEMBLA0A2P6RBA21e-95A0A2P6RBA2_ROSCH; Putative transcription factor NAM family
STRINGXP_004306167.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3240422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.14e-18NAC-like, activated by AP3/PI