PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00000082_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 194aa    MW: 22707.8 Da    PI: 10.0857
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00000082_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM134.38.1e-4281151107
                               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrk 74 
                                       +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL+      ++e++ewyfFs++dkky+tg+r+
  FANhyb_icon00000082_a.1.g00001.1   8 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQDrcrIGYEEQNEWYFFSHKDKKYPTGTRT 83 
                                       69****************************.9***************953432234667****************** PP

                               NAM  75 nratksgyWkatgkdkevlskkgelvglkktLv 107
                                       nrat +g+Wkatg+dk+v++ k++l+g++ktLv
  FANhyb_icon00000082_a.1.g00001.1  84 NRATMAGFWKATGRDKSVYD-KSKLIGMRKTLV 115
                                       ********************.999********8 PP

2NAM81.61.7e-2511617470129
                               NAM  70 tgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                       tg+r+nrat +g+Wkatg+dk+v++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  FANhyb_icon00000082_a.1.g00001.1 116 TGTRTNRATMAGFWKATGRDKSVYD-KSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 174
                                       799**********************.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-426115IPR003441NAC domain
PROSITE profilePS5100548.7288194IPR003441NAC domain
PfamPF023653.4E-209115IPR003441NAC domain
SuperFamilySSF1019413.27E-25116179IPR003441NAC domain
PfamPF023651.7E-11120173IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MESIESTVPP GFRFHPTDEE LVGYYLRKKV ASQKIDLDVI RDIDLYRIEP WDLQDRCRIG  60
YEEQNEWYFF SHKDKKYPTG TRTNRATMAG FWKATGRDKS VYDKSKLIGM RKTLVTGTRT  120
NRATMAGFWK ATGRDKSVYD KSKLIGMRKT LVFYKGRAPN GQKTDWIMHE YRLESDENGP  180
PQASNTEKHH RSPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-44517312140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021908313.12e-98NAC domain-containing protein 37-like
RefseqXP_024183159.13e-98NAC domain-containing protein 37
SwissprotO655084e-92NAC76_ARATH; NAC domain-containing protein 76
TrEMBLA0A1R3IPU64e-97A0A1R3IPU6_9ROSI; No apical meristem (NAM) protein
TrEMBLA0A498KME85e-97A0A498KME8_MALDO; Uncharacterized protein
STRINGXP_004287828.13e-97(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45653459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36160.12e-94NAC domain containing protein 76
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]