PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462968062
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 749aa    MW: 83132.5 Da    PI: 5.0201
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462968062genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS352.94.9e-1083707403373
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +l + cA+av++gd + a +lL ++++++sp+gd++qRla++f+e+L+arla+++se+yk+l +++ts   + e l a+kl+  ++ +  +++   N++I
  462968062 370 NLCIYCAQAVATGDRRSAMELLRQIKQHSSPSGDATQRLAHCFAEGLEARLAGTGSEVYKSLMSKRTS---VMEYLEAYKLYLAACCFRMMAFKFSNKTI 466
                56689*********************************************************999999...9**************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                 + ++g ++vHi+D+++ +G+QWp+Ll++La+R++gpp++RiTg++ p++g   + +leetg+rL++ A ++gvpf+f+  +a ++e++++++L+++p+E
  462968062 467 FNLIAGRKKVHIVDYGMHYGFQWPNLLRSLADREGGPPEVRITGIDLPQPGfrPAARLEETGRRLSRRACQFGVPFKFHS-IAAKWEMVRVDDLNIDPDE 565
                **************************************************9*9***************************.799**************** PP

       GRAS 201 alaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +l+Vn +++l +llde  +l+s  +rd vL+ +++++P+ +++   + +hns+ F++rf ea+ yysa+fd ++a+ pr++e+r  vEr l+g ++ nvv
  462968062 566 VLIVNGIVHLANLLDEGNDLDSlsPRDVVLNNIRKMQPDAFILFVMNGSHNSPFFVTRFREAMFYYSAMFDIMDATTPRDNEQRLLVERDLFGSAALNVV 665
                ****************99999988**************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                aceg +r+er et+++W+ r ++aG++p+pl+ +a+k ++  +r  + + + ++ ++++l+ gWk+r L+++SaW
  462968062 666 ACEGLDRVERPETYKQWHVRNQRAGLRPLPLDPEAVKHVRETVRSQYHKDFVIDMDRQWLLEGWKGRVLYAMSAW 740
                ***********************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.365342721IPR005202Transcription factor GRAS
PfamPF035141.7E-105370740IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MAALPEESVE PFSPSLFLDL PPTPRPDGGG DGGDPASSDD LVLPYISRML MEDDIDDKFF  60
YQYPDHPVLL QTQEPYAKIL SDAATGSSSS DSSTTNADGG SGSSTLSPSF SSEAPASGDA  120
IWPCDPIELA QLLRSPPCPE MEVALDGFTA DDVSAFLPAQ DGATEGLQKS PTQLGNASSA  180
VDNRAHSPAT SEEETKTKST ANLPSADGDK DTLLSALFSG QNRESMDMLN LAFFKGMEEA  240
KKFLPNNNNL LVGLNSTSGD HLPRDSKVKE TVDETLFSQR SGNGRGRKNR QDLDYLEAET  300
GRNSKLMMRE PEESGEIVDE TVFNGYELCL KEMQGLRIAM GSDAKKNTRK GDRKSGKGRQ  360
STSQVVDLHN LCIYCAQAVA TGDRRSAMEL LRQIKQHSSP SGDATQRLAH CFAEGLEARL  420
AGTGSEVYKS LMSKRTSVME YLEAYKLYLA ACCFRMMAFK FSNKTIFNLI AGRKKVHIVD  480
YGMHYGFQWP NLLRSLADRE GGPPEVRITG IDLPQPGFRP AARLEETGRR LSRRACQFGV  540
PFKFHSIAAK WEMVRVDDLN IDPDEVLIVN GIVHLANLLD EGNDLDSLSP RDVVLNNIRK  600
MQPDAFILFV MNGSHNSPFF VTRFREAMFY YSAMFDIMDA TTPRDNEQRL LVERDLFGSA  660
ALNVVACEGL DRVERPETYK QWHVRNQRAG LRPLPLDPEA VKHVRETVRS QYHKDFVIDM  720
DRQWLLEGWK GRVLYAMSAW VADDSKNFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-433737409374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450063.10.0hypothetical protein SORBIDRAFT_05g027750
RefseqXP_008677823.10.0PREDICTED: scarecrow-like protein 34
TrEMBLC5Y8L30.0C5Y8L3_SORBI; Putative uncharacterized protein Sb05g027750
STRINGSb05g027750.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-149GRAS family protein