PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462966519
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HD-ZIP
Protein Properties Length: 192aa    MW: 21741 Da    PI: 6.5305
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462966519genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.4e-2070122456
                -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                ++++  eq+++Le++Fe +++++ +++ ++A+ lgL+ rqV vWFqNrRa++k
  462966519  70 KRRLALEQVRALERCFETDNKLDPDRKSRIARDLGLQPRQVAVWFQNRRARWK 122
                4567789*********************************************9 PP

2HD-ZIP_I/II1284.1e-4168159192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ eqv++LE++Fe+++kL+p+rK+++ar+LglqprqvavWFqnrRAR+ktkqlE+d++aL +++dal+++ ++L++++++L++e++
    462966519  68 EKKRRLALEQVRALERCFETDNKLDPDRKSRIARDLGLQPRQVAVWFQNRRARWKTKQLERDFAALCSRHDALRADCDALRRDKDALAAEVR 159
                  69*************************************************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.42E-1961126IPR009057Homeodomain-like
SMARTSM003893.3E-1967128IPR001356Homeobox domain
PROSITE profilePS5007116.35868124IPR001356Homeobox domain
CDDcd000868.53E-1469125No hitNo description
PfamPF000466.2E-1770122IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-2076123IPR009057Homeodomain-like
PRINTSPR000311.9E-595104IPR000047Helix-turn-helix motif
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PRINTSPR000311.9E-5104120IPR000047Helix-turn-helix motif
PfamPF021834.8E-12124159IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MKRQSKRPTR SHESTEPGEK LAFSEEEPLT ARNMEHEDQA EMDDVDEDDD EELASGRAAR  60
SSSCGLGEKK RRLALEQVRA LERCFETDNK LDPDRKSRIA RDLGLQPRQV AVWFQNRRAR  120
WKTKQLERDF AALCSRHDAL RADCDALRRD KDALAAEVRG IALSRRTHTG AEAKAVQAGD  180
DDGEVGGGRQ RQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116124RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462966519
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1214891e-129AC121489.2 Oryza sativa Japonica Group chromosome 3 clone OJ1217B09, complete sequence.
GenBankAP0149591e-129AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798128.18e-77homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP34e-63HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0A9PIJ14e-79A0A0A9PIJ1_ARUDO; Uncharacterized protein
STRINGPavir.Ia04906.1.p2e-77(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.26e-31homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]