PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462964340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 169aa    MW: 18467.8 Da    PI: 6.5113
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462964340genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.81.4e-36171171101
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca+dCvl+pyfpa+qp+++a vh +FG+sn ++ll++lp +er +a+++++ eA++r++dPvyG++g+i +lqqq++ ++ +la+++++
  462964340  17 RCAACKYLRRRCAPDCVLSPYFPASQPRRYADVHAVFGTSNATRLLQSLPVQERGRAADTMATEARWRVQDPVYGSAGIIDRLQQQIRAAQRDLATTRAQ 116
                6**********************************************************************************************99987 PP

     DUF260 101 l 101
                l
  462964340 117 L 117
                5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.27216117IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-3617114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MSSSGSIAGN NNPWTRRCAA CKYLRRRCAP DCVLSPYFPA SQPRRYADVH AVFGTSNATR  60
LLQSLPVQER GRAADTMATE ARWRVQDPVY GSAGIIDRLQ QQIRAAQRDL ATTRAQLAFP  120
PPPSTLLLPP PAAAASAIDG GRLLAVRHEE EEEEAPPMDP DEFLDLGDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-321811712111LOB family transfactor Ramosa2.1
5ly0_B1e-321811712111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap462964340
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022683529.13e-65LOB domain-containing protein 24
SwissprotP594673e-36LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594683e-36LBD24_ARATH; LOB domain-containing protein 24
TrEMBLK3YMP02e-66K3YMP0_SETIT; Uncharacterized protein
STRINGSi015521m3e-67(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.19e-38LOB domain-containing protein 23