PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462963922
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LFY
Protein Properties Length: 317aa    MW: 34740.5 Da    PI: 9.8372
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462963922genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY476.22e-145130381385
    FLO_LFY  81 mkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekk 180
                m+++eldd+m++l+ +fr+d+l+Ger+G++aa+raer r+++      r   l+   +t lda+sqe+ls+e+++     +g +++g   ++l+++++  
  462963922   1 MTERELDDMMAALAGLFRWDVLLGERFGLRAALRAERGRVMALGGGGGRF--LQ-TGSTCLDAVSQEVLSDERDAAASGGMGDDETGRRLHQLAGKKQ-- 95 
                9*****************************************98666666..44.45678************88654444444444433333333332.. PP

    FLO_LFY 181 seeekkkaskk..kqkrkkkkelkse....ededeeeeed.edeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiaker 273
                 +++k  a++k  k++rk++ +         ded   e+d ++++++g +g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr fLlqvq+iak  
  462963922  96 -QAKKGAATRKgkKARRKRELR---PldvlGDEDGAGESDsTESSTGGGGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCRVFLLQVQTIAKMA 191
                .222222222211222222222...124555555555544055556777888************************************************ PP

    FLO_LFY 274 GekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtk 373
                G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k+rgenvGawrqacy+plv+iaar+g+d+davf+ahprLsiWYvPt+
  462963922 192 GHKSPTKVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKARGENVGAWRQACYAPLVEIAARHGFDVDAVFAAHPRLSIWYVPTR 291
                **************************************************************************************************** PP

    FLO_LFY 374 LrqLChlerska 385
                LrqLCh++r  +
  462963922 292 LRQLCHQARGGH 303
                ********9766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.8E-1571303IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MTERELDDMM AALAGLFRWD VLLGERFGLR AALRAERGRV MALGGGGGRF LQTGSTCLDA  60
VSQEVLSDER DAAASGGMGD DETGRRLHQL AGKKQQAKKG AATRKGKKAR RKRELRPLDV  120
LGDEDGAGES DSTESSTGGG GGGERQREHP FVVTEPGEVA RAKKNGLDYL FHLYEQCRVF  180
LLQVQTIAKM AGHKSPTKVT NQVFRYAKKC GASYINKPKM RHYVHCYALH CLDEEASNAL  240
RRAYKARGEN VGAWRQACYA PLVEIAARHG FDVDAVFAAH PRLSIWYVPT RLRQLCHQAR  300
GGHAHAAAAG LPPPPMY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1011423022162PROTEIN LEAFY
2vy2_A1e-1011423022162PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462963922
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976675.11e-175probable transcription factor FL
SwissprotQ0JAI11e-159FL_ORYSJ; Probable transcription factor FL
TrEMBLK3YC121e-174K3YC12_SETIT; Uncharacterized protein
STRINGSi011756m1e-175(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-98floral meristem identity control protein LEAFY (LFY)