PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462963665
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 883aa    MW: 99719.9 Da    PI: 7.0451
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462963665genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP121.63.7e-38124200278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                Cqv+gC+adls  ++yh+rhkvCe+h+++ vv ++g+e+rfCqqCsrfh l+efDe+k+sCr+rLa+hn rrrk q+
  462963665 124 CQVDGCQADLSGSRDYHKRHKVCEAHTRSRVVRIKGIEHRFCQQCSRFHLLQEFDEGKKSCRSRLAQHNGRRRKVQP 200
                **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-31117185IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.026121198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-35122202IPR004333Transcription factor, SBP-box
PfamPF031109.7E-30124197IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.49E-5647761IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 883 aa     Download sequence    Send to blast
MEAGFLWKEN GNRTDAAGMS GGHNNRSVEW DLNDWRWDTN LFLATPSSAA PSERGGRDTI  60
RSQGEIDFGV VDKRRRVSPE DDSAECSNSV VANRENHGVV VQRGRSSEEE RPRKGARSSS  120
SPSCQVDGCQ ADLSGSRDYH KRHKVCEAHT RSRVVRIKGI EHRFCQQCSR FHLLQEFDEG  180
KKSCRSRLAQ HNGRRRKVQP HATTDGNSVV DNQSLRSTLF LLLKQLSGLE SGSSSERIDH  240
PNYLINILKN FASIAGTQAY QEILKNANST SISSNAGNHV ANGFSMHDQN RPPLRVVTES  300
SAEEHPVKRR VQNFDLNDAC VEDAESRTDK IVFKLFGKEP KDFPVNLREQ ILNWLSHYPS  360
EMESYIRPGC VILTIYLRLP NWIWDEFDDD PAPWIEKLIS MSNDGFWETG WVYARVQNWL  420
TLICNGSLVL ASPWQSLIGD KHQRLYVTPI AVACSSTAKF SVKGFNIVQP TTKLLCIFGE  480
KHLIQEETQM LLEDTTIQQD PQCLSFSCSF PSTSGRGLIE IEDYDQSSLS VPFVVTDEDI  540
CLEIRMLEQE LNLISDCETL EHIDDSMASH NRALYFLQEF GWLLQRSHMR AMSDQAQYCT  600
EGFPVGRFRW LLSFAVDHEW CAVVKKLLNI MFQGNLDVPS PVEFVQGLNL LFIAVNKRSK  660
LLVECLLRYT TANYAPVDTG ATTPVQFLFT PQMTGPSNIT PLHTAATISD ASGVLDALTN  720
DPQQMGIKVW KNARDATGFT PEDYARKKGF ISYIQLVQEK IDRKIPKEHI SIAIASEPST  780
TNVVGKHNSR MNFADKTTFD VEKSHSSIKQ PVSCNRCVQQ LTYRPKTSRF LSTRPAVLSL  840
VAIAAVCVCV GLLMKSPPHV GCMRPFIWEH IKWGPTIWTI WYD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-27118197584squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17276KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462963665
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9431004e-32EU943100.1 Zea mays clone 1560552 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819590.10.0squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_025819591.10.0squamosa promoter-binding-like protein 1 isoform X1
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLA0A2S3HWL10.0A0A2S3HWL1_9POAL; Uncharacterized protein
STRINGPavir.Ea01625.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang H,Zhai J,Mo J,Li D,Song F
    Overexpression of rice sphingosine-1-phoshpate lyase gene OsSPL1 in transgenic tobacco reduces salt and oxidative stress tolerance.
    J Integr Plant Biol, 2012. 54(9): p. 652-62
    [PMID:22889013]
  3. Zhang H, et al.
    Molecular characterization of rice sphingosine-1-phosphate lyase gene OsSPL1 and functional analysis of its role in disease resistance response.
    Plant Cell Rep., 2014. 33(10): p. 1745-56
    [PMID:25113543]