PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462962883
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family CPP
Protein Properties Length: 771aa    MW: 83528.5 Da    PI: 6.452
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462962883genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.6e-16457495240
        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                ++k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  462962883 457 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 495
                689**********************************96 PP

2TCR50.25e-16542581140
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  462962883 542 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNTF 581
                589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.7E-17456497IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.38457582IPR005172CRC domain
PfamPF036388.7E-12459494IPR005172CRC domain
SMARTSM011143.5E-16542583IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11544580IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MDTPDRPLAP PASRAEDSPL FGFIDNLSPI EPVKSAYTAT SLQGYQTINI TSISSIFTSP  60
HDNAQKEPRL LKSPLAQISE TEDCAEGSDR SKTSTKSANA VRLFASTSTV TQETQTVTCS  120
VVVDHPDGPC DLSQTAGQFD TGSPDHNTTP CHGVRSDLKQ DKCRKIEAVH TIKNTLEKRK  180
CLFSTEIQLD GSQPEKDSDE VMGCQWSDLI STTSGELLAY DTSIDEHHRG VQLAVNNAES  240
CGYLLSKLTG DGEPAAAGSA YYQELMMGED QIENTQIFQD GQPIISTEEI QDNIYDANGG  300
IPLGYKVETQ QQRGIRRRCL VFEASGFSNS LVQKETVEDM SGSSKGKSPV ETKISKSKLQ  360
SRVPRGIGLH LNALTATPKG KMACQDPMAS ALVPASTSEH DMHGKLLSAG EKFTHSGGEL  420
LELPMDDSEG FPDLVSSQSG SPQKKRRKAD NGDDGESCKR CSCKKSKCLK LYCECFAAGV  480
YCSEPCSCQG CLNKPIHEEI VLSTRKQIEF RNPLAFAPKV IRMSETGQET GEDPNNTPAS  540
ARHKRGCNCK KSSCLKKYCE CYQGGVGCSS NCRCESCKNT FGRRDADIEL TEEMKQEGEE  600
TKICGEKEND QQKANVQNED HPLLELVPIT PPFDVSSSLL LKPPNFSSAK PPRPTKARSS  660
NSRSSASKVT ETVQSRKISK VANSGRNEEM PDVLREDNSP STCVKTTSPN GKRVSPPHNA  720
LSISPNRKGG RKLILKSIPS FPSLMGEANN SSAMNSVDSK LSAPPLALGP S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1546157914120Protein lin-54 homolog
5fd3_B2e-1546157914120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1443447KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462962883
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799594.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A2S3GWC50.0A0A2S3GWC5_9POAL; Uncharacterized protein
STRINGSb02g004250.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.17e-82TESMIN/TSO1-like CXC 2