PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462961643
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 96aa    MW: 10035.7 Da    PI: 9.5348
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462961643genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26062.51.1e-192368146
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46
               +CaaCk+lrr+Ca++C+++pyf   +p+kfa+vhk+FGasnv+k+l
  462961643 23 PCAACKLLRRRCAQECPFSPYFSPLEPHKFAAVHKVFGASNVSKML 68
               7*******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.9342296IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-192368IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MPAASGLGAA GAGPGSALNT ITPCAACKLL RRRCAQECPF SPYFSPLEPH KFAAVHKVFG  60
ASNVSKMLLV GRIQISLSKE VSSQDTKACS VTIRTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-1723681156LOB family transfactor Ramosa2.1
5ly0_B1e-1723681156LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap462961643
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1343412e-60AC134341.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0027N19, complete sequence.
GenBankAP0149612e-60AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126132e-60CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167556.12e-33LOB domain-containing protein 15-like
SwissprotQ9AT618e-33LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A3B5YTY61e-33A0A3B5YTY6_WHEAT; Uncharacterized protein
TrEMBLA0A446JPG51e-33A0A446JPG5_TRITD; Uncharacterized protein
TrEMBLM7ZFV16e-34M7ZFV1_TRIUA; Uncharacterized protein
STRINGPavir.Ca01098.1.p5e-36(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.12e-32LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]