PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462961466
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 193aa    MW: 21068.1 Da    PI: 7.2078
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462961466genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26074.12.7e-2384146971
     DUF260   9 rrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearard 71 
                 r+Ca++Cvlapyfp ++p+kf  +h++FGasn++kll++lpe+ r da+ss+vyeA+a+ r+
  462961466  84 XRRCADGCVLAPYFPPTEPAKFTTAHRVFGASNIIKLLQDLPESSRADAVSSMVYEADAKERQ 146
                589********************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.59475175IPR004883Lateral organ boundaries, LOB
PfamPF031956.8E-2384148IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
DCSNAGSTGP TTAQQYCYRS ESPPSRVSSS CSPPPTPPAA QLQLVGNVAP XXXXXXXXXX  60
XXXXXXXXXX XXXXXXXXXX XXXXRRCADG CVLAPYFPPT EPAKFTTAHR VFGASNIIKL  120
LQDLPESSRA DAVSSMVYEA DAKERQANEL KVQLARAQAD LLNAQAQHAN LLALLCVDMA  180
NNNRRDGQNS QQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-228518120121LOB family transfactor Ramosa2.1
5ly0_B2e-228518120121LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap462961466
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9539374e-78EU953937.1 Zea mays clone 1449845 LOB domain protein 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987050.22e-61LOB domain-containing protein 1
TrEMBLA0A368SSE35e-60A0A368SSE3_SETIT; Uncharacterized protein
STRINGSi037280m1e-60(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.19e-32LOB domain-containing protein 11