PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462960979
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 198aa    MW: 22504.7 Da    PI: 7.8595
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462960979genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.54.8e-30959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienk+ rqvtf+kRrng+lKKA+ELSvLCdaeva+iifss+g+l+e+s+
  462960979  9 KRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLFEFST 59
               79***********************************************96 PP

2K-box80.53.9e-2781159987
      K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 
                +  + + + +qe+ kLk ++e Lq++qR+llGedL++Ls keL+qLe+q+e slk+iRs K + ll+q+ el++k +e+
  462960979  81 APLEAELNNYQEYLKLKTRVEFLQTTQRNLLGEDLGPLSTKELEQLENQIEISLKHIRSAKGQQLLDQLFELKRKIQET 159
                4444556889*****************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.207161IPR002100Transcription factor, MADS-box
CDDcd002651.10E-43278No hitNo description
SuperFamilySSF554557.06E-33288IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-32323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-323859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.34886196IPR002487Transcription factor, K-box
PfamPF014861.6E-2187158IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGRGKVELKR IENKISRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSS RGRLFEFSTS  60
SCMYKTLERY RSCNQSSEAS APLEAELNNY QEYLKLKTRV EFLQTTQRNL LGEDLGPLST  120
KELEQLENQI EISLKHIRSA KGQQLLDQLF ELKRKIQETG SCEDLPPMTL QDVGPSSHAN  180
EPSQELRLGV CDPSLHIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-21831551486Developmental protein SEPALLATA 3
4ox0_B2e-21831551486Developmental protein SEPALLATA 3
4ox0_C2e-21831551486Developmental protein SEPALLATA 3
4ox0_D2e-21831551486Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:16217607, ECO:0000269|PubMed:9085264, ECO:0000269|Ref.8}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462960979
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6616001e-175JN661600.1 Eleusine coracana MADS5-like protein (OSM5) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964768.11e-110MADS-box transcription factor 5
SwissprotA2Y9P01e-109MADS5_ORYSI; MADS-box transcription factor 5
SwissprotQ0DEB81e-109MADS5_ORYSJ; MADS-box transcription factor 5
TrEMBLA0A3L6PB351e-109A0A3L6PB35_PANMI; MADS-box transcription factor 5-like
STRINGSi007226m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22213264
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.34e-70MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cui R, et al.
    Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa).
    Plant J., 2010. 61(5): p. 767-81
    [PMID:20003164]