PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462960925
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 242aa    MW: 27693.7 Da    PI: 8.7586
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462960925genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.14.9e-28959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien++nrqvtfskRr g+lKKA+EL vLCda+v v+ifsstgk++ey+s
  462960925  9 KRIENSTNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCS 59
               79***********************************************96 PP

2K-box63.38.9e-2271157186
      K-box   1 yqkssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                yq++++++  e ++ ++   e++++k+e+++L++ +R++ G+dL+sL+l +++ LeqqLe s++k+R++K+ell++q+++l++k ++
  462960925  71 YQHTTNNHfEEINHDQQIFLEMTRMKNEVDQLETGLRRFTGDDLSSLTLTDINDLEQQLELSVNKVRTRKHELLTQQLDNLRRKVRA 157
                66666777777788899999****************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.282161IPR002100Transcription factor, MADS-box
CDDcd002653.78E-42278No hitNo description
SuperFamilySSF554556.15E-33289IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-1981156IPR002487Transcription factor, K-box
PROSITE profilePS5129712.09685171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRGGLLK KANELAVLCD ARVGVVIFSS TGKMFEYCSP  60
TSSLRELIEQ YQHTTNNHFE EINHDQQIFL EMTRMKNEVD QLETGLRRFT GDDLSSLTLT  120
DINDLEQQLE LSVNKVRTRK HELLTQQLDN LRRKVRAHLG RPEQHSVPHD QRQPAGREPR  180
RREAGGDDAA GDAAAGGLXX XXXXXXXXXX XXXXXXGFRL QPTQPNLQDL HHGHGLQLWP  240
HI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A7e-19185183MEF2C
5f28_B7e-19185183MEF2C
5f28_C7e-19185183MEF2C
5f28_D7e-19185183MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462960925
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2712080.0AJ271208.1 Zea mays mRNA for putative MADS-domain transcription factor (m17 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021316104.11e-104MADS-box protein ZMM17 isoform X1
SwissprotQ8VWM81e-101M17_MAIZE; MADS-box protein ZMM17
TrEMBLA0A1D6H1J31e-101A0A1D6H1J3_MAIZE; Zea mays MADS17
TrEMBLA0A3L6ESV61e-101A0A3L6ESV6_MAIZE; MADS-box protein ZMM17
STRINGSb04g004736.11e-101(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.21e-48MIKC_MADS family protein