PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462960620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 518aa    MW: 56704.7 Da    PI: 9.8207
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462960620genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.21.3e-39244321178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +CqvegC++dls+ak+yhr+hk+Ce+hskap+v+v+gle+rfCqqCsr h l efD++krsCrrrL++hn+rrrk++a
  462960620 244 CCQVEGCNVDLSSAKDYHRKHKICEAHSKAPKVVVAGLERRFCQQCSRLHGLAEFDQNKRSCRRRLSHHNARRRKPHA 321
                6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.2E-33237306IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.983242319IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-37244324IPR004333Transcription factor, SBP-box
PfamPF031101.8E-31245318IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MAGSRVGNRA WERRFSSPRR ISMLSTLGFA DQTAQFVASF DCPFGCDNPQ FPHKHLWAAV  60
EIVISGMGSS GMNWNHKNSM VWEWGNLTPG PNTIENLNSR ALPKPRDADM VAIRHGSVSS  120
SDATFTSSSE VGHGSSKSSL SASIGSPLRE GNVLEFNFAA VSKRDMNMKN GKAGRVEDSG  180
TSSPSMIAIC HGEPLISLRL GKRNYFKNVR GGQDVKNSAT TGATCPLTVV KKTKMSQQST  240
QNSCCQVEGC NVDLSSAKDY HRKHKICEAH SKAPKVVVAG LERRFCQQCS RLHGLAEFDQ  300
NKRSCRRRLS HHNARRRKPH ADAISFSSSR LPTMFYSSPR QQTEPFFNQP PFSQVRSNAV  360
SLWDNLEGFR FTEVKFPPTK PKKLVGFDET HFSTSQLSNA VVAHDVHHHN LDDPVMSLKG  420
TNIKAVNQGM EASTIASNLN GAPVIGRALS LLSDDSWVSN STVNQQPRSH VHAGALPHLA  480
SVAATNPFMD ELDSTNGGFW QDPPPLDGTL QIQSSAHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-272453181184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462960620
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966343.11e-175squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_004966344.11e-175squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_004966345.11e-175squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_022681748.11e-175squamosa promoter-binding-like protein 12 isoform X1
SwissprotA2YGR51e-160SPL12_ORYSI; Squamosa promoter-binding-like protein 12
TrEMBLA0A3Q8AKY80.0A0A3Q8AKY8_9POAL; Squamosa-promoter binding protein-like protein
STRINGSi006471m1e-174(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-38squamosa promoter binding protein-like 2