PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462957694
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HD-ZIP
Protein Properties Length: 247aa    MW: 26929.2 Da    PI: 5.3474
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462957694genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65.2e-193588356
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               k++++ ++q+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  462957694 35 KKRRLAADQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 88
               4557899**********************************************9 PP

2HD-ZIP_I/II126.11.6e-4034123190
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                  ekkrrl+++qv++LE+sFe+++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+dy aL+++ydal++++++L++++++L +e
    462957694  34 EKKRRLAADQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQMERDYVALRHSYDALRADHDALRRDKDALLAE 123
                  69***********************************************************************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-191491IPR009057Homeodomain-like
PROSITE profilePS5007116.4223090IPR001356Homeobox domain
SuperFamilySSF466894.23E-183092IPR009057Homeodomain-like
SMARTSM003892.1E-183394IPR001356Homeobox domain
PfamPF000462.6E-163588IPR001356Homeobox domain
CDDcd000869.59E-183591No hitNo description
PROSITE patternPS0002706588IPR017970Homeobox, conserved site
PfamPF021833.7E-1390123IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MMERDDVVAA GAYNDEEEED EDDDLGAGRG GLGEKKRRLA ADQVRALERS FEADNKLDPE  60
RKARIARDLR LHPRQVAVWF QNRRARWKTK QMERDYVALR HSYDALRADH DALRRDKDAL  120
LAEARPRAAA GAATAAVYKQ DGSTDSDSSA VFNEEASPYS GGAAATPTAF DHHHHNPHLH  180
PSFAAGFTSF LASSSALSSS FPSMYSGGGS HLVDQEADHG LLGAADGFFA EDQHGTGLGS  240
WYGGEGW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18290RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462957694
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0997531e-94FP099753.1 Phyllostachys edulis cDNA clone: bphyem212a11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001141777.14e-83uncharacterized protein LOC100273913
RefseqXP_008668033.14e-83putative homeobox DNA-binding and leucine zipper domain family protein isoform X1
SwissprotQ338Z74e-73HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A3Q8H9652e-82A0A3Q8H965_FESAR; Class I homeodomain-leucine zipper protein 8
STRINGPavir.J35191.1.p3e-83(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.16e-33homeobox protein 16
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]