PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462956970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TCP
Protein Properties Length: 213aa    MW: 23350.7 Da    PI: 11.2838
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462956970genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP90.14.7e-2886137152
        TCP   1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLl 52 
                aa++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t+eWL 
  462956970  86 AAAGKRPSKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKTDGETVEWLG 137
                5789**********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.2E-2393136IPR005333Transcription factor, TCP
PROSITE profilePS5136919.29793147IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MDHGGAAASS STSTSTNSSR SASEQQQHPH HHPFYYXXXX XXXXXXXXXX XXXXXXXXXX  60
XXXXGWSSGG GGAADSSSSK KQVAPAAAGK RPSKDRHTKV DGRGRRIRMP ALCAARVFQL  120
TRELGHKTDG ETVEWLGRXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXSPPCS  180
DGTTTATTNS SSCRRRRRIS NSSSSKIPAP ASS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00228DAPTransfer from AT1G72010Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462956970
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3610024e-60AK361002.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1130G02.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72010.16e-26TCP family protein