PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462956324
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HD-ZIP
Protein Properties Length: 291aa    MW: 31917.9 Da    PI: 5.4173
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462956324genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.8e-1967120356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++ ++q+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  462956324  67 KKRRLAADQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 120
                4557899**********************************************9 PP

2HD-ZIP_I/II126.98.7e-4166158193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl+++qv++LE+sFe+++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+dy aL+++ydal++++++L++++++L +e++e
    462956324  66 EKKRRLAADQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQMERDYVALRHSYDALRADHDALRRDKDALLAEIRE 158
                  69*************************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-1945123IPR009057Homeodomain-like
SuperFamilySSF466895.56E-1861124IPR009057Homeodomain-like
PROSITE profilePS5007116.42262122IPR001356Homeobox domain
SMARTSM003892.1E-1865126IPR001356Homeobox domain
CDDcd000863.48E-1667123No hitNo description
PfamPF000463.4E-1667120IPR001356Homeobox domain
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
PfamPF021832.9E-16122162IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0009737Biological Processresponse to abscisic acid
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MKRPASRGSS VPVISQETPE QQEDSSVRYS MMEREDVVAG AGAYNEEEEE DEEDDDLGGG  60
RGGLGEKKRR LAADQVRALE RSFEADNKLD PERKARIARD LRLHPRQVAV WFQNRRARWK  120
TKQMERDYVA LRHSYDALRA DHDALRRDKD ALLAEIRELR EKAEKQMAVK PRPLAATTAA  180
AAAVYKQDGS TDSDSSAVFN EEASPYSGGA AATATAFDHH HNPHLHPSFA GFTSFLASSG  240
ALSSSFPSMY SGGGSHLDQE GDHGLLGAAD GFFAEDHHGT GLGSWYGGEG W
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114122RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00587DAPTransfer from AT5G65310Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462956324
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0997533e-98FP099753.1 Phyllostachys edulis cDNA clone: bphyem212a11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792352.11e-102homeobox-leucine zipper protein HOX8-like isoform X1
SwissprotQ338Z77e-86HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A0A9JEK41e-104A0A0A9JEK4_ARUDO; Uncharacterized protein
STRINGPavir.J35191.1.p1e-107(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.27e-37homeobox protein 5
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]