PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462951861
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TCP
Protein Properties Length: 255aa    MW: 27400.6 Da    PI: 10.4544
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462951861genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP91.81.5e-2848116371
        TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 
                g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WL+ +a+++i++l+ + ++++ 
  462951861  48 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLIDAAQHEIDKLPPLHFPPQD 116
                78*************************************************************666652 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.4E-2649109IPR005333Transcription factor, TCP
PROSITE profilePS5136929.40249107IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MISGGNQRND EVQGAGCRKL QAVTASSRHS SWPASTESRI VRVSRVFGGK DRHSKVRTVK  60
GLRDRRVRLS VPTAIQLYDL QDRLGLSQPS KVVDWLIDAA QHEIDKLPPL HFPPQDHRPP  120
PRGPPAARFG LGHAAIKAAG LMAGLNNNSI NPLAHSLFFA GESNWNNNNN GSTTTTVHDP  180
QTSTLAHHHS PFSSLLSLAP GPQLVFYSPE GGGGFAMKEA ADHQFPVDSI DHSSHGGQLS  240
LSSSARSFLH SGTQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-2054108155Putative transcription factor PCF6
5zkt_B1e-2054108155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00008PBMTransfer from 496250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462951861
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9563581e-85EU956358.1 Zea mays clone 1561243 TCP family transcription factor containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440063.11e-95transcription factor PCF8 isoform X1
RefseqXP_021304103.11e-95transcription factor PCF8 isoform X1
TrEMBLC5Z0W33e-94C5Z0W3_SORBI; Uncharacterized protein
STRINGSb09g025340.16e-95(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.11e-36plastid transcription factor 1