PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462951446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 972aa    MW: 106079 Da    PI: 5.92
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462951446genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.89.6e-41151228178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +CqvegC adl+ ak+yhrrhkvCe+h+ka++++v ++ qrfCqqCsrfh l+efDe krsCrrrLa+hn+rrrk+++
  462951446 151 ACQVEGCGADLTAAKDYHRRHKVCEMHAKASTAVVGNTVQRFCQQCSRFHLLQEFDEWKRSCRRRLAGHNRRRRKTRP 228
                5**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-33144213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.291149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38150230IPR004333Transcription factor, SBP-box
PfamPF031109.7E-30152225IPR004333Transcription factor, SBP-box
PROSITE profilePS5029710.02756823IPR020683Ankyrin repeat-containing domain
SMARTSM002480.15756785IPR002110Ankyrin repeat
SuperFamilySSF484032.02E-8759863IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.204.4E-8760864IPR020683Ankyrin repeat-containing domain
CDDcd002043.02E-10761861No hitNo description
SMARTSM00248410802832IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 972 aa     Download sequence    Send to blast
MEAARLGAQS SHLYGGGLVE LDMNRREKRV FGWDLNDWSW DSERFVATPV PSSVANGSAL  60
NSSPSSSEEA EAEAARNGAV RGESDKRKRV VVIDDDGTED QDLMGNSSGA LSLRIGGDSV  120
GAGTMENDGV NEEERNGKKI KVQGGSSSGP ACQVEGCGAD LTAAKDYHRR HKVCEMHAKA  180
STAVVGNTVQ RFCQQCSRFH LLQEFDEWKR SCRRRLAGHN RRRRKTRPDI GLGGAASIED  240
KVSNYLLLSL LGICANLNSG NSEHSSGQEL LSNLLRNLGT VAKSLEPKEL SKLLEACQSL  300
QNGSNAGISG TANALVNNSA AEAAGPSNSK PLFMNGNQCG QTSSSAMPIQ SKAAMAAIPE  360
PRACKVKDFD LNDTCDDMEG FENGEEGSPT PAFMTADSPN CPSWMQQDST QSPPQTSGNS  420
DSTSTQSLSS SNGDAQCRTD KIVFKLFEKV PSDLPPVLRS QILGWLSSSP TDIESYIRPG  480
CVILTVYLRL VESSWRELSD NMSSHLDKLL NSSSDNFWAS GLVLVMVRHQ LAFMYNGRVM  540
LDRPLAPSSY HYCRILCIKP VAAPYSAAVN FKVEGINLIN ASSRVICSFE GRCLFQEDTA  600
IVADDAELED RDTECLSFCC PLPGSRGRGF IEVEDSGFSN GFFPFIIAEQ DVCSEVTELE  660
SIFESSSHEL ADVDDVARSQ ALEFLNELGW LLHRANSTSK HDKTEPSLAT FNLWRFRNLG  720
IFAMEREWCA VMKMLLDFLF IGLVDVGSQS PEEVVLSENL LHIAVRRKSV QMVRFLLRYK  780
PNKNSKGTAP MHLFRPDALG PSTITPLHIA ASTGDAEDVL DALTDDPGLV GISAWKHAQD  840
GTGFTPEDYA RQRGNDAYLN LVQKKIDKHL SKGHVVLGVP SSMCPVTNDG VKPGNVSLEI  900
CRSMPMAKCH LCSRQALKYP RSAVRTFLYR PAMLTMMGVA VVCVCVGILL HTMPKVYAAP  960
TFRWELLERG AM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31145225484squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462951446
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466159.10.0squamosa promoter-binding-like protein 6
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLA0A0A9REY00.0A0A0A9REY0_ARUDO; Uncharacterized protein
STRINGSb01g002530.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]