PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462951294
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 630aa    MW: 71212.7 Da    PI: 5.9504
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462951294genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.41.5e-902516212373
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                + lL+ cA+a+++g+++ a +lL++++++as +gd++qRla++f e+L+arla+++s++ k l  +  s   + e l a+kl   +s ++k++ +    +
  462951294 251 RMLLILCAQAIATGNHASACELLKQIRQHASAKGDATQRLAQCFCEGLEARLAGTGSNVNKFLLDRCPS---VREFLEAYKLCMAASGFYKVALVFNIAT 347
                679*********************************************************999988888...9*************************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                Il a+eg++r+Hi+ f+   GlQW++Ll +La+R++gpp++RiT ++ p++    +e++eet  rL++  +++g+pf+f+  ++ ++e++++e+L+++ +
  462951294 348 ILHAMEGKSRLHIVEFGTIFGLQWASLLCQLANREGGPPEVRITSIDCPQPRslPTERIEETVCRLSNTDRKFGLPFKFHS-IVAAWEAVSVEDLNTNAD 446
                *************************************************99999***************************.6999************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                E l+Vn  ++l +l+des  l++  +++ vL+ ++++ P+v++ +  +++  ++sFl+rf eal y++alfd+l+a++prese r ++E+ l+gr + nv
  462951294 447 ELLVVNDLFNLSTLMDESIFLDNpnPKEMVLNNIQKMCPDVFIQSIVNCSS-GTSFLTRFREALFYFTALFDMLDATIPRESESRLVLEQGLFGRCALNV 545
                ******************98888668999**************99999998.789********************************************* PP

       GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                +aceg++   r e++++W+ r ++aG++++pl+ ++++ ++  + k++ + + + e++++l+ gW++r L++ S W
  462951294 546 IACEGQDLMDRPEKYRQWQVRNKRAGLRQLPLKPNIVQIVRDKVMKFHHKDFLLGEDDQWLIHGWMGRVLFAHSTW 621
                ************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.876224602IPR005202Transcription factor GRAS
PfamPF035145.1E-88251621IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MAITPEKFFV ESLMEAIPPS PSAFIDLPQS HVDDGEDQLT MDDSLLPHIS RVLMEDEIED  60
NILYSDHPAL LKVQRPFAQI LFSDSFRTNN DTTEPHASVP PPVTDRGNTA VGNNGLLLCN  120
DDHRKLNSDL SKGIDAVDAF LRGVEEASRL LPNNSDFRRG ELVDNVCSES ITHKVLKKRY  180
NRDKHLEDEV GRARKSLMSM KEMEKIRELF DDLMLHSSEA CMRDMKKLRV AMDNEILKHA  240
KKAAMDTVDL RMLLILCAQA IATGNHASAC ELLKQIRQHA SAKGDATQRL AQCFCEGLEA  300
RLAGTGSNVN KFLLDRCPSV REFLEAYKLC MAASGFYKVA LVFNIATILH AMEGKSRLHI  360
VEFGTIFGLQ WASLLCQLAN REGGPPEVRI TSIDCPQPRS LPTERIEETV CRLSNTDRKF  420
GLPFKFHSIV AAWEAVSVED LNTNADELLV VNDLFNLSTL MDESIFLDNP NPKEMVLNNI  480
QKMCPDVFIQ SIVNCSSGTS FLTRFREALF YFTALFDMLD ATIPRESESR LVLEQGLFGR  540
CALNVIACEG QDLMDRPEKY RQWQVRNKRA GLRQLPLKPN IVQIVRDKVM KFHHKDFLLG  600
EDDQWLIHGW MGRVLFAHST WVANDAPFSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-322546218374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK10.0K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.11e-119GRAS family protein