PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462951291
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 317aa    MW: 36657.6 Da    PI: 6.9087
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462951291genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS216.21.7e-66730874373
       GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAee 171
                + e l+a++l  e++ + +++ +    +I  a+eg++r+Hi+ f+ + Gl Wp++++ L + ++gpp++R+T +  pe     +e +eetg rL++ A++
  462951291   7 VLEFLKARRLCMEACCFNQVALVFNIMTITHAMEGKKRLHIVEFGTNFGLEWPCFFHRLGNWEGGPPEVRLTSICCPEIRffPTEGIEETGCRLSNWARK 106
                678999**********************************************************************998899****************** PP

       GRAS 172 lgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                lg+pf+f++ +++++e++ +e+L+++p+E+l+V+  ++l  l+desv  ++  ++d+vL  +++++P+v++ +  + + +s+sFl+rf eal y++ lfd
  462951291 107 LGIPFRFHA-ITTDWEAVCIEDLDTNPDEVLVVCDNFNLSILMDESVYFDNasPKDRVLGKIREMRPTVFIQSIVNRS-SSTSFLTRFREALFYFMGLFD 204
                *********.6999********************************99888779**************9987766654.589****************** PP

       GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                +l+a+ pr+se r+++E+ l+g ++ n++aceg +   r e++++W+ r ++aG++++pl+ ++    +  + + + + + + +++++l+ gW++r L++
  462951291 205 MLDATTPRDSEPRMVLEQGLFGCAVLNIIACEGMDLMDRPEKYRQWKLRNQRAGLRQLPLKPDIIPVLRDKVMNLHHKDFYLGKDDEWLIHGWMGRVLTA 304
                *********************************************************************9999999888********************* PP

       GRAS 370 vSaW 373
                 S+W
  462951291 305 HSVW 308
                **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.0321289IPR005202Transcription factor GRAS
PfamPF035146.1E-647308IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAKRPSVLEF LKARRLCMEA CCFNQVALVF NIMTITHAME GKKRLHIVEF GTNFGLEWPC  60
FFHRLGNWEG GPPEVRLTSI CCPEIRFFPT EGIEETGCRL SNWARKLGIP FRFHAITTDW  120
EAVCIEDLDT NPDEVLVVCD NFNLSILMDE SVYFDNASPK DRVLGKIREM RPTVFIQSIV  180
NRSSSTSFLT RFREALFYFM GLFDMLDATT PRDSEPRMVL EQGLFGCAVL NIIACEGMDL  240
MDRPEKYRQW KLRNQRAGLR QLPLKPDIIP VLRDKVMNLH HKDFYLGKDD EWLIHGWMGR  300
VLTAHSVWVA KEVPSSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-211926585329GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450075.11e-128hypothetical protein SORBIDRAFT_05g027810
TrEMBLC5Y1S91e-128C5Y1S9_SORBI; Putative uncharacterized protein Sb05g027810
STRINGSb05g027810.11e-127(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.12e-73GRAS family protein