PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462950639
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 2312aa    MW: 260466 Da    PI: 9.1313
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462950639genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.94.3e-1441126697
                ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                +p++ + + ++++p+ f++++ gk   s t++le+++g  ++v++    +  ++v+++GW+ F + +++ke Df++F+++++s f   v ++
  462950639  41 MPKSRSDLTLIIVPNGFLKHFAGK--LSGTIKLESPNGSIYDVEI--AERYTKMVFRRGWETFINTHHIKEDDFLLFQHIENSPF--EVLIL 126
                567777788899******888877..677****************..8888999**************************99999..66555 PP

2B3452e-142593451399
                TT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-.SSSEE..EEEEE-S CS
         B3  13 sgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkld.grsefelvvkvfrk 99 
                +  lv++kk+a +h   +++s+++tl+ + + ++W  ++ y+++++r ++l++ W +Fv +n+++egD+++F  + gr++f+++v ++r+
  462950639 259 NTHLVISKKYAFTHF--PHKSMDVTLQRPGNsKKWHPRF-YKRNDNRlCMLKGQWLDFVCDNHVQEGDICLFLPIkGRRKFTFMVYLLRT 345
                4569*******9997..56899******5555*******.88888888*************************77355*******99987 PP

3B3438e-143694571199
                HHTT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-.SSSEE..EEEEE-S CS
         B3  11 lksgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkld.grsefelvvkvfrk 99 
                +k +  v++kk+a +h   +++s+++tl+ + + ++W  ++ y+++++r ++l++ W +Fv +n+++egD+++F  + gr++f+++v ++r+
  462950639 369 TKMASAVISKKYAFTHF--PHKSMDVTLQRPGNsKKWHPRF-YKRNDNRlCMLKGQWLDFVCDNHVQEGDICLFLPIkGRRKFTFMVYLLRT 457
                4555679******9997..56899******5555*******.88888888*************************77355*******99987 PP

4B334.82.9e-115776283990
                EETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
         B3  39 edesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                 +   + W+ k+ +  +++r +l++GW  Fv +ngL+ gD+++F+l++++++
  462950639 577 LHCMRKIWKTKMVILPGRRRWFLRQGWPTFVWDNGLRIGDICLFELKKNERK 628
                4446699*****9999999**************************9986443 PP

5B341.23e-136637431198
                HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                +k++  ++p++f++++ gk   s t++le+++g  ++v +    + +++vl+ GW+ Fv+ ++++e+D+++F+++ + +f   v++f+
  462950639 663 FKHN-TIMPNRFLKHFTGK--LSGTIKLESPNGCLYDVHV--IDRYDKMVLGHGWEAFVDVHHINENDSLLFRHITECRF--EVSIFD 743
                4555.778*****888777..6779***************..55555779***********************9998888..999987 PP

6B337.93.2e-128689511699
                EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE-S CS
         B3  16 lvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfrk 99 
                l + k++a +h   ++e++ +tl+   ++++W  k+  rk ++ ++l++ W +Fv++n++ egD++vF  ++  ++ +++v+++r+
  462950639 868 LAITKEYAFAHF--PHETTNVTLQRpGTSKKWHPKFYKRKDRSVHLLRGKWLDFVRDNNVHEGDICVFLPTKGaEKYTFTVHLLRA 951
                568888888886..345668999994566*******44555555*************************88666999999999886 PP

7B3383e-12106011381494
                 T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EE CS
         B3   14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvv 94  
                 ++l l  ++a++  +++ +++t++l+    ++W+ k+ +  +++ry l +GW++Fv++ngL++gD+++++l+++ ++ ++  
  462950639 1060 SMLELGSRYATAVHLPS-RGQTVVLKY-MRKVWKAKMAVHCGGRRY-LCGGWSKFVRDNGLRVGDICLLQLKKNeRKLTMEA 1138
                 55667777787777765.455666655.889******655555555.667*********************98756655555 PP

8B340.35.7e-13144315072189
                 HH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
         B3   21 kfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89  
                 +fa+ h ++ +e++t++l+    + We k+ y  ++++ +l +GW +Fv++ngL++gD+++F+l++++e
  462950639 1443 RFASVH-LP-AEGQTVVLQ-CGRKIWETKMMYHTGRRW-TLNRGWPNFVRDNGLRVGDICLFELKKNEE 1507
                 666555.33.345566655.4789******77777655.79**********************998754 PP

9B337.73.7e-12167217531497
                 T-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE CS
         B3   14 grlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvf 97  
                 + l ++ ++a++h   +++s+ +tle   ++++W   +   k+ g+++l++ W +Fvk+n+L+egD++++  +++ ++ +++v+++
  462950639 1672 ASLGISAEYASAHF--PPKSTNVTLERpGKSKKWHPSY--YKHNGACMLRGQWLDFVKDNHLQEGDICLLFPTKDgRKLSFTVHIL 1753
                 56789999**9998..447889*****5566*******..9***************************998777667777777776 PP

10B332.71.3e-10186619441595
                 -EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEE CS
         B3   15 rlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvk 95  
                  l ++ k+a++h   ++es+ ++le +   ++W   +   k++g++vl++ W +Fvk+n+++ gD++++  ++  ++ +++v+
  462950639 1866 SLAISAKYASAHF--PHESTIVKLERPGKrKKWHPSY--YKHKGACVLGGQWFDFVKDNHVQKGDICLLFPTKGgRKLSFTVH 1944
                 578999***9997..457889*****55549******..****************************9875543355555555 PP

11B333.95.5e-11205521351496
                 T-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEE CS
         B3   14 grlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkv 96  
                 + l ++ k+a++h   ++es+ +tle   ++++W   +   k++g +vl++ W +Fvk+n+++egD++++  +++ ++ +++v++
  462950639 2055 ASLAISAKYASAHF--PHESTNVTLERlGTSKKWHPSY--YKHKGLCVLRGEWIDFVKDNHVQEGDICLLFPTKDgRKLSFTVHL 2135
                 557899*******7..457889*****6677*******..****************************99866655666666655 PP

12B337.44.4e-1222172307397
                 EE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE CS
         B3    3 kvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvf 97  
                  v+++ dv  s+ l + +++ae++    +++s++++    +gr+W+ ++  + +s+r +l +GW+ Fv++n L+ gD++++  + + +e +++v+++
  462950639 2217 AVMSKRDVIGSCELEFGRRYAEANlP-GTRRSVEII---CTGRTWKAQM--SVRSNRWFLCGGWSTFVRDNILRIGDICLIIPKMNgRELSMMVRII 2307
                 578999******************63.457888888...688*******..99999999999*****************998765557777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.67436129IPR003340B3 DNA binding domain
PfamPF023624.1E-1241125IPR003340B3 DNA binding domain
SMARTSM010191.1E-443129IPR003340B3 DNA binding domain
SuperFamilySSF1019368.44E-1745131IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-1549131IPR015300DNA-binding pseudobarrel domain
CDDcd100171.19E-1251127No hitNo description
Gene3DG3DSA:2.40.330.101.9E-18238344IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.02E-18241344IPR015300DNA-binding pseudobarrel domain
CDDcd100171.66E-18246341No hitNo description
SMARTSM010193.2E-8246346IPR003340B3 DNA binding domain
PROSITE profilePS5086311.97247346IPR003340B3 DNA binding domain
PfamPF023629.9E-13258345IPR003340B3 DNA binding domain
PROSITE profilePS5086310.8359458IPR003340B3 DNA binding domain
SMARTSM010190.0047366458IPR003340B3 DNA binding domain
PfamPF023624.4E-12368457IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-13372456IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.71E-14374456IPR015300DNA-binding pseudobarrel domain
CDDcd100173.42E-15375453No hitNo description
Gene3DG3DSA:2.40.330.104.9E-15533626IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.28E-15535631IPR015300DNA-binding pseudobarrel domain
CDDcd100177.07E-14539632No hitNo description
SMARTSM010190.0038541631IPR003340B3 DNA binding domain
PfamPF023624.1E-9574629IPR003340B3 DNA binding domain
PROSITE profilePS508639.502582636IPR003340B3 DNA binding domain
SuperFamilySSF1019363.79E-18649747IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.2E-16650746IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.63652745IPR003340B3 DNA binding domain
CDDcd100171.12E-15654743No hitNo description
SMARTSM010199.0E-7655745IPR003340B3 DNA binding domain
PfamPF023627.3E-11662743IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.6E-18845952IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.44E-17845951IPR015300DNA-binding pseudobarrel domain
CDDcd100179.35E-15852947No hitNo description
SMARTSM010190.0019860952IPR003340B3 DNA binding domain
PfamPF023625.4E-10868951IPR003340B3 DNA binding domain
PROSITE profilePS5086311.209868952IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.3E-1710371137IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.15E-1510381131IPR015300DNA-binding pseudobarrel domain
CDDcd100176.16E-1610431143No hitNo description
SMARTSM010193.3E-610451146IPR003340B3 DNA binding domain
PROSITE profilePS5086310.44710471144IPR003340B3 DNA binding domain
PfamPF023624.4E-1010601140IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-1511891293IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.22E-1511891293IPR015300DNA-binding pseudobarrel domain
CDDcd100175.29E-1611951293No hitNo description
SMARTSM010190.002811951295IPR003340B3 DNA binding domain
PROSITE profilePS508639.81211961295IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.0E-1713851406IPR015300DNA-binding pseudobarrel domain
SMARTSM010199.0E-614321522IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.0E-1714391507IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.44E-1414401507IPR015300DNA-binding pseudobarrel domain
PfamPF023621.3E-1014421508IPR003340B3 DNA binding domain
CDDcd100175.26E-1214421506No hitNo description
PROSITE profilePS5086310.65914631521IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.8E-1916501754IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-1816511754IPR015300DNA-binding pseudobarrel domain
CDDcd100172.34E-1616581753No hitNo description
SMARTSM010192.8E-516581756IPR003340B3 DNA binding domain
PROSITE profilePS5086310.70116591756IPR003340B3 DNA binding domain
PfamPF023622.1E-1016721753IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.3E-1718431947IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-1618441947IPR015300DNA-binding pseudobarrel domain
CDDcd100175.31E-1318511944No hitNo description
PROSITE profilePS508639.37518521949IPR003340B3 DNA binding domain
SMARTSM010190.004818561949IPR003340B3 DNA binding domain
PfamPF023622.6E-818661945IPR003340B3 DNA binding domain
SuperFamilySSF1019368.83E-1720342137IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.6E-1720342137IPR015300DNA-binding pseudobarrel domain
CDDcd100175.22E-1420412136No hitNo description
SMARTSM010195.7E-420412139IPR003340B3 DNA binding domain
PROSITE profilePS5086310.17920422139IPR003340B3 DNA binding domain
PfamPF023624.6E-920552136IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-1422072297IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-1322082294IPR015300DNA-binding pseudobarrel domain
CDDcd100171.20E-1522132307No hitNo description
PROSITE profilePS5086310.13722152310IPR003340B3 DNA binding domain
SMARTSM010193.8E-522152310IPR003340B3 DNA binding domain
PfamPF023622.6E-1022162307IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2312 aa     Download sequence    Send to blast
MTVRLPPPSS AFAGRSSAEG VAQQQGPRRP RPFDARTHPQ MPKSRSDLTL IIVPNGFLKH  60
FAGKLSGTIK LESPNGSIYD VEIAERYTKM VFRRGWETFI NTHHIKEDDF LLFQHIENSP  120
FEVLILDSDG CEKPFPCAGI KNIPSVRERT TEYTDISSSS EHDSTKLSRR QRNARWEKGH  180
PSHSTSSSSE DSGKDFSSEN KSPESDDLQM AQGADYVLSR GNSLSEAQKE RVLALIQEIK  240
PDITVFVAIM RKSNVQLPNT HLVISKKYAF THFPHKSMDV TLQRPGNSKK WHPRFYKRND  300
NRLCMLKGQW LDFVCDNHVQ EGDICLFLPI KGRRKFTFMV YLLRTSASGS SRVETGFERT  360
GPRYGRSSTK MASAVISKKY AFTHFPHKSM DVTLQRPGNS KKWHPRFYKR NDNRLCMLKG  420
QWLDFVCDNH VQEGDICLFL PIKGRRKFTF MVYLLRTSAS GSSRVETGFE RTGPRYGRSS  480
TKMASAVHIK EESTEEEYQE SDSDSLSEPP YIVALKSCLS RSQKTIVEKR VRAIQSEFPI  540
FVAIMTKSTI GDAINCRIEF GVRSARHLPD RGQTMILHCM RKIWKTKMVI LPGRRRWFLR  600
QGWPTFVWDN GLRIGDICLF ELKKNERKPT MEKPCDCCKR YLNHLDEKNQ NMTCFLRRMT  660
GNFKHNTIMP NRFLKHFTGK LSGTIKLESP NGCLYDVHVI DRYDKMVLGH GWEAFVDVHH  720
INENDSLLFR HITECRFEVS IFDPDDCEKM FRHITKRHRN SQHDTTDSSG SQKSARSDKG  780
RHGKTAGMAA ISSSSDASGK GSSSESESLE SNDLEIPTGT DYVISSRSCL SEAQKERVIA  840
FIREIEPEVT VFVAILKKCH VQPPVPSLAI TKEYAFAHFP HETTNVTLQR PGTSKKWHPK  900
FYKRKDRSVH LLRGKWLDFV RDNNVHEGDI CVFLPTKGAE KYTFTVHLLR ATSTGCVGGT  960
GLQKVGPDPG RSNNAEMASE DIKEERTDGI TAKREHAWNE CLENEDFGRP SQPPYILPAR  1020
NHLSKSQKKI IVKKVQAIQS ELPIYVAFMS KSSVGDPQRS MLELGSRYAT AVHLPSRGQT  1080
VVLKYMRKVW KAKMAVHCGG RRYLCGGWSK FVRDNGLRVG DICLLQLKKN ERKLTMEAHI  1140
IFREHPSENE SLDSSNLQAF PGVDYVVSRT SYLTEAQTEK VIAFIQKTKP EITVFVAVMR  1200
KSNIQPPGPC LGISKEYALA HFPHTSKNVT LQMPGKSKKW HPIFYKRDES RKNMLMGQWL  1260
DFVRDNHVHE GDICFLAPEK GGGRSTFNVY LLRTTLAHSR CVAGFQRGGP CRGGSIANIA  1320
SEVHMMEKQN DEQHISSESG MHESSRGSLE CEVSDDPFQP PYIVPCRSHL SKSPKKIVEQ  1380
KVRAIKSKVP ICVAIMKNNN VGVAQPKSIY IACQDSGYMH LSAGERKCAA NFISIIFQEL  1440
GSRFASVHLP AEGQTVVLQC GRKIWETKMM YHTGRRWTLN RGWPNFVRDN GLRVGDICLF  1500
ELKKNEEAYN EEHCVRSVRR YWFQTSSGTL HRLQVFCCPP IGYVLNAYKS VVELLAADLL  1560
RSCQYGTTES SETSKRFAKC QKGSSCHHGK IVVMATTSSP SEESGDDTPS ENESLESDDP  1620
QALLVADFVL PRRSYLSEEQ KDRVIAHIQE IKPDITVFVA VMHRTHVQPP SASLGISAEY  1680
ASAHFPPKST NVTLERPGKS KKWHPSYYKH NGACMLRGQW LDFVKDNHLQ EGDICLLFPT  1740
KDGRKLSFTV HILHTTAADS RGGTSFQSVS SCGGRSRVHV PPESDAHGVS TGSMEDSGDD  1800
TPSENGSLES DDFQAPPVAD YVLSLGSYLS EAQKDRVIAH IQEIRPDVTV FVAIMHKTNV  1860
QPPCASLAIS AKYASAHFPH ESTIVKLERP GKRKKWHPSY YKHKGACVLG GQWFDFVKDN  1920
HVQKGDICLL FPTKGGRKLS FTVHLLHATA ADSRGGTSFQ NVTSCCGVNV PPENGAHGIS  1980
TGSIEDSEDD TPSENGSSES DDFQAPRMTD YVLPLRSYLS EAQKDRVIAH IQEIKPGITV  2040
FVAIMQKTHV QPPSASLAIS AKYASAHFPH ESTNVTLERL GTSKKWHPSY YKHKGLCVLR  2100
GEWIDFVKDN HVQEGDICLL FPTKDGRKLS FTVHLLHATA ADSRGGTGFQ SVSACCGVHV  2160
PLENDAHGIS TGSMEDCGDP SKPPYILSCK NHLSEPEKKI VEYKVRAIQS EVPIYVAVMS  2220
KRDVIGSCEL EFGRRYAEAN LPGTRRSVEI ICTGRTWKAQ MSVRSNRWFL CGGWSTFVRD  2280
NILRIGDICL IIPKMNGREL SMMVRIIYRE DL
Cis-element ? help Back to Top
SourceLink
PlantRegMap462950639
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982421.10.0B3 domain-containing protein Os03g0619600
RefseqXP_004982422.10.0B3 domain-containing protein Os03g0619600
RefseqXP_012698169.10.0B3 domain-containing protein Os03g0619600
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.19e-18B3 family protein