PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462945705
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family G2-like
Protein Properties Length: 264aa    MW: 27960.6 Da    PI: 6.58
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462945705genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like73.92.3e-2374118246
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+h+
  462945705  74 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHM 118
                9*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.08E-871117IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-1972118IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-1574117IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
VGLYNPYHPS SAWPSSLRSS TTAPASASSA DTAAAAFLSP SAYHRMLSGT GRLHLHGVLA  60
MPRLPASRRG MRAPRMRWTS TLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHMYR  120
TVKSTDKPAT SSGPIDGGGS GDDDLPNAEQ AQSGGDINRQ PFAGHRSASS DGATSQAGGG  180
DVECSSADDS DGCRARSTSS RDQWLPSRAC NGDSHRSACV SSTIEDDTEP CRSASLQQIS  240
NQEMGNPSLE FTLGRPNWDS AEHD
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462945705
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2865288e-62DQ286528.1 Zea mays KANADI1-like protein (kan1b) mRNA, partial cds.
GenBankEU9350038e-62EU935003.1 Zea mays cultivar B73 kanadi1 (kan1) mRNA, complete cds.
GenBankJX4699828e-62JX469982.1 Zea mays subsp. mays clone UT3342 G2-like transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973472.11e-110probable transcription factor RL9
SwissprotQ0J2352e-69ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A3L6RKZ81e-109A0A3L6RKZ8_PANMI; Putative transcription factor RL9
STRINGSi013716m1e-110(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-41G2-like family protein