PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462943921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 151aa    MW: 16185.3 Da    PI: 11.2887
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462943921genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26069.38.4e-2296147152
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpee 52 
                aCaaCk++rrkC++dC+lapyfpa+q+++f  +h+lFG+sn+lk+l++l+++
  462943921  96 ACAACKYQRRKCNADCPLAPYFPADQQRRFLHAHRLFGVSNILKTLRRLRPD 147
                7**********************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.8795151IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-2096147IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MVPDSVPDNC PAGLRIHLVV TSASVGNARG FSSSSTGAWN LANAGTTTFH NNDLLLRRHG  60
RLPRPAPPPH SAHPSPRGGN GSNGVGSPSS SQQNQACAAC KYQRRKCNAD CPLAPYFPAD  120
QQRRFLHAHR LFGVSNILKT LRRLRPDLCA A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126164e-53CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankAP0149644e-53AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0053884e-53AP005388.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0086F04.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-20LOB domain-containing protein 22