PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462943545
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family bHLH
Protein Properties Length: 92aa    MW: 10373.7 Da    PI: 8.5297
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462943545genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH247.1e-0820591554
               HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
        HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
               +i +  ++L++llP+a  +++ ++  a +L+++++YI+sL
  462943545 20 QISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRSL 59
               789999*********889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.102.4E-8378IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.683559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474596.15E-91879IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000104.9E-52059IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSNRRSRSRQ SGSSRITEEQ ISDLVSKLQD LLPEARLQSN ARVPSARVLQ ETCNYIRSLH  60
REVDGLSERL SELLATSDMS SAQEAIIRSL LM
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462943545
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2297762e-50AC229776.1 Oryza minuta clone OM__Ba0117B03, complete sequence.
GenBankAC2297872e-50AC229787.1 Oryza minuta clone OM__Ba0057D03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985540.22e-44transcription factor ILI6
RefseqXP_025792689.11e-44transcription factor ILI6 isoform X2
SwissprotB8APB51e-42ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR21e-42ILI6_ORYSJ; Transcription factor ILI6
TrEMBLA0A2T8I6933e-43A0A2T8I693_9POAL; Uncharacterized protein
TrEMBLA0A368SV834e-43A0A368SV83_SETIT; Uncharacterized protein
TrEMBLA0A3L6S9J83e-43A0A3L6S9J8_PANMI; Transcription factor ILI6
TrEMBLK4AH743e-43K4AH74_SETIT; Uncharacterized protein
STRINGSi038231m5e-44(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-30bHLH family protein