PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462942512
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family bHLH
Protein Properties Length: 221aa    MW: 24070.1 Da    PI: 8.4861
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462942512genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH30.37.6e-103987654
               HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
        HLH  6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
               +e+ErrRR++++    +L +llPk   +++  +s    L +A  YIk+L
  462942512 39 KEIERRRRQEMRRLCVKLASLLPKEQYTSKDTMSQLGSLDEAAAYIKKL 87
               79**********************65677777***************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.6073387IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.109.9E-1338102IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.7E-73987IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474596.28E-1139104IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.2E-63993IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MEVKEKRGRS SRTAEAGGKS STSNNSSGSG TATAGVERKE IERRRRQEMR RLCVKLASLL  60
PKEQYTSKDT MSQLGSLDEA AAYIKKLKER VEELQQKRSS VQLVADMTRG AGGALTSAAT  120
STSGNSGSEE AAAEEAVPAP VVEVRHHNDG LSLDLVLVSS VERPFKLHEV VTVLEEEGAE  180
IINANFSVTG QQIFYTIHCR AFCSRIGIEF SRVSERLRAL V
Cis-element ? help Back to Top
SourceLink
PlantRegMap462942512
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025818432.19e-87transcription factor bHLH162-like
TrEMBLA0A2S3HX222e-85A0A2S3HX22_9POAL; Uncharacterized protein
STRINGPavir.Ea00786.1.p4e-91(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82936133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G10586.13e-12bHLH family protein