PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462941473
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 242aa    MW: 28027.6 Da    PI: 8.6844
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462941473genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.57.2e-281666151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien  nrqvtfskRr+g+lKKA+EL vLCd++ av ifs++gkl+eys+
  462941473 16 KRIENRVNRQVTFSKRRKGLLKKAHELAVLCDVQLAVFIFSERGKLFEYSN 66
               79***********************************************95 PP

2K-box44.56.6e-161592231276
      K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleq 76 
                + +++l  e+++L +e e+L++++R   GedL+ Ls+ eL+ Leq L++ l+k+R++K++ll + 
  462941473 159 HRSQQLLMEMTRLTNEKEQLESNIRISTGEDLSLLSVDELNDLEQYLQSVLSKVRARKTQLLDDL 223
                56789999*****************************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.09E-26868IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-37867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.796868IPR002100Transcription factor, MADS-box
CDDcd002658.57E-34970No hitNo description
PRINTSPR004042.5E-281030IPR002100Transcription factor, MADS-box
PfamPF003195.8E-241764IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-283045IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-284566IPR002100Transcription factor, MADS-box
PfamPF014864.2E-14160235IPR002487Transcription factor, K-box
PROSITE profilePS5129711.016161242IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MLSVQVAMGR GRVELKRIEN RVNRQVTFSK RRKGLLKKAH ELAVLCDVQL AVFIFSERGK  60
LFEYSNPPCR YACLLGFLIS NILTSGMPDC HNCDDYKLQF FLPITMPVSI IQCTDMLPLT  120
GFQSMSDLIR RYEIASNTQQ LHEAHRHDQR SLLMRIALHR SQQLLMEMTR LTNEKEQLES  180
NIRISTGEDL SLLSVDELND LEQYLQSVLS KVRARKTQLL DDLRRKVLIV NHEQSHVVIQ  240
TC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-15865158MEF2C
5f28_B1e-15865158MEF2C
5f28_C1e-15865158MEF2C
5f28_D1e-15865158MEF2C
6byy_A1e-15866159MEF2 CHIMERA
6byy_B1e-15866159MEF2 CHIMERA
6byy_C1e-15866159MEF2 CHIMERA
6byy_D1e-15866159MEF2 CHIMERA
6bz1_A1e-15866159MEF2 CHIMERA
6bz1_B1e-15866159MEF2 CHIMERA
6bz1_C1e-15866159MEF2 CHIMERA
6bz1_D1e-15866159MEF2 CHIMERA
Cis-element ? help Back to Top
SourceLink
PlantRegMap462941473
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.31e-29MIKC_MADS family protein