PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462940833
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 298aa    MW: 31764.4 Da    PI: 8.1579
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462940833genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP73.24.7e-2338823478
               EETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP 34 lvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
               +++g  qrfCqqCsrfh l efDe krsCr+rL++hn+rrrk+q+
  462940833 38 AAAGPFQRFCQQCSRFHLLCEFDEVKRSCRKRLDGHNRRRRKPQP 82
               567888************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114116.691180IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.8E-213585IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.5E-113867IPR004333Transcription factor, SBP-box
PfamPF031105.6E-153879IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDWDAKMPSW DLGTVVGPSS GGALDLKLGG PTSWKAAAAA GPFQRFCQQC SRFHLLCEFD  60
EVKRSCRKRL DGHNRRRRKP QPDPMNPGAL FGNHHGMTRF TSYPQLFSAP SMADSKWPAT  120
TIVKAETDAF QDHYYPAVHL NNGAVSLFNG KDRKHFPFLT PHGGDAAAAL GCQPFTITPS  180
SESSSKQSNG NCALSLLSDN QTPAQLMIPT GQPLGAALHY GNVARLPDDG DVSLTGMSYV  240
SVGGKQTSIV ATSAGHTATA ASPAPATQLQ YHGYYHVNGG DQGNSDGASI QALPFSSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-1540794584squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16279KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462940833
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971091.11e-125squamosa promoter-binding-like protein 2
SwissprotQ0JGI11e-79SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLK3XIT11e-124K3XIT1_SETIT; Uncharacterized protein
STRINGPavir.J02262.1.p1e-125(Panicum virgatum)
STRINGSi001804m1e-125(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.15e-21SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]