PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462940434
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 113aa    MW: 12640.2 Da    PI: 9.9689
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462940434genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.52.6e-40275578
               TT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP  5 egCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
               ++C a+l eak+yh+rhkvCe+h+kapvv+v+gl+qrfCqqCsrfhelsefD+ krsCr rLa+hnerrrk++a
  462940434  2 DRCGAELGEAKRYHKRHKVCEAHAKAPVVIVAGLRQRFCQQCSRFHELSEFDDIKRSCRLRLAGHNERRRKSSA 75
               79*********************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114129.487173IPR004333Transcription factor, SBP-box
PfamPF031109.8E-31272IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.106.2E-30260IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-36277IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
ADRCGAELGE AKRYHKRHKV CEAHAKAPVV IVAGLRQRFC QQCSRFHELS EFDDIKRSCR  60
LRLAGHNERR RKSSAEAHGP PPPGPSSSDP CRHADQDGRS HPGNPPLGNF QIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-331721384squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462940434
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0916729e-72FP091672.1 Phyllostachys edulis cDNA clone: bphylf033o15, full insert sequence.
GenBankFP0944789e-72FP094478.1 Phyllostachys edulis cDNA clone: bphyst005i03, full insert sequence.
GenBankFP0966269e-72FP096626.1 Phyllostachys edulis cDNA clone: bphylf027p18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560169.31e-51squamosa promoter-binding-like protein 13
SwissprotQ6Z4614e-44SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLA0A385UKL66e-55A0A385UKL6_WHEAT; GLW7
TrEMBLA0A446M6U66e-55A0A446M6U6_TRITD; Uncharacterized protein
TrEMBLA0A446M6X22e-55A0A446M6X2_TRITD; Uncharacterized protein
STRINGTraes_2BS_186EA570A.11e-55(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85243248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.21e-36squamosa promoter binding protein-like 4