PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462939980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 27301.3 Da    PI: 8.3057
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462939980genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.51.9e-244591248
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
               rien   rqvtf+kRr+g+lKKA ELSvLCda + +iifs +gkly+
  462939980 45 RIENPVHRQVTFCKRRAGLLKKARELSVLCDAHIGIIIFSAHGKLYD 91
               8********************************************97 PP

2K-box28.56.5e-111241951686
      K-box  16 slqqelakLkkeienLqreqRhllGedLe.sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                  +qe   L++ei+ Lq+ +R + G+  +  ++++eL+ Le+ Le  + +iRs K+ +l++  e lq+k  e
  462939980 124 DPKQETMVLQQEINLLQKGLRYIYGNRANeHMTVEELNALERYLEIWMYNIRSAKEGMLKAANEILQEKIVE 195
                5689999******************998626************************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.3523696IPR002100Transcription factor, MADS-box
SMARTSM004328.1E-353695IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-2736111IPR002100Transcription factor, MADS-box
CDDcd002651.80E-3937114No hitNo description
PRINTSPR004045.2E-263858IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003892IPR002100Transcription factor, MADS-box
PfamPF003194.0E-234590IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-265873IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-267394IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.549122212IPR002487Transcription factor, K-box
PfamPF014866.0E-12125192IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
PRVEAQGTAA TSKLVQTSGR LSAGGRGRRS YLVTSMARGK VQLRRIENPV HRQVTFCKRR  60
AGLLKKAREL SVLCDAHIGI IIFSAHGKLY DLATTGTMEE LIERYKTASG EAQQGDGCGD  120
QIMDPKQETM VLQQEINLLQ KGLRYIYGNR ANEHMTVEEL NALERYLEIW MYNIRSAKEG  180
MLKAANEILQ EKIVEQSGLL DVGMMVADQQ NGHFSTVPLI EEITNPLTIL SGYSSCRGSE  240
MGYSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-1636105169MEF2C
5f28_B6e-1636105169MEF2C
5f28_C6e-1636105169MEF2C
5f28_D6e-1636105169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462939980
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972486.11e-145MADS-box transcription factor 26
SwissprotA2YQK91e-141MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-141MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0A9TEC71e-144A0A0A9TEC7_ARUDO; Uncharacterized protein
STRINGSi014419m1e-144(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-51AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]