PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462939414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family M-type_MADS
Protein Properties Length: 276aa    MW: 30397.7 Da    PI: 5.7172
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462939414genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.41.4e-211053245
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
               + en+s rq+t+skRr gilKKA+ELS+LCd++  +++fs+tgk
  462939414 10 KLENSSGRQITYSKRRSGILKKAKELSILCDIDLILLMFSPTGK 53
               679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.6E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.474153IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-22170IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-17323IPR002100Transcription factor, MADS-box
PfamPF003194.7E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRQIT YSKRRSGILK KAKELSILCD IDLILLMFSP TGKPTICIGE  60
RSPSVSAAYE AFRVQTSDQD VNPFAFFQFQ NDMQLPLGLT GDPNASSWFH NGGADVHQPM  120
MLPDDPSLLH QRDIGCSTST SLQSYPGYFS MSKQSTDTGG GSEHGQPSSV QQQPPDFGQA  180
ECLKSELYLG AQFPYTPFDH TSLLNERMFR PDGVELHDGG AGMDFGGGHF DLPRPGDEAS  240
FQNWASAACG TGMFDHHQHQ QQEQQQQQPP SAQNHD
Cis-element ? help Back to Top
SourceLink
PlantRegMap462939414
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693378e-59KF469337.1 Brachypodium distachyon MADS-box transcription factor 43 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025828481.12e-97agamous-like MADS-box protein AGL65
TrEMBLA2ZGK01e-111A2ZGK0_ORYSI; Uncharacterized protein
STRINGLPERR11G18320.11e-109(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69540.12e-18AGAMOUS-like 94