PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462937082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 147aa    MW: 15977.4 Da    PI: 9.5874
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462937082genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26054.63.1e-17282191
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91
               +C++C+vlr++C+++Cvl+p++   +++                  +a+pe++r+++++sl+yeA  r+ +Pv+Gavg++ +++++l+q++
  462937082  2 SCNGCRVLRKGCSEGCVLRPCLQWIDTAX----------XXXXXXXSAVPEDQRPALFQSLLYEAAGRTINPVNGAVGLLGAGSWHLCQAA 82
               6********************87766544..........3456788999***************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.636192IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4224IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-83882IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MSCNGCRVLR KGCSEGCVLR PCLQWIDTAX XXXXXXXSAV PEDQRPALFQ SLLYEAAGRT  60
INPVNGAVGL LGAGSWHLCQ AALTRRLLVG WVTIAFAQRL LRGEARRGTA PRLVGYGVDE  120
GINARGVHGA QRMRASPLEI DGERSRQ
Cis-element ? help Back to Top
SourceLink
PlantRegMap462937082
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432387e-36AC243238.1 Panicum virgatum clone PV_ABa020-K10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983938.15e-38LOB domain-containing protein 37
SwissprotQ9FN117e-35LBD37_ARATH; LOB domain-containing protein 37
TrEMBLA0A0A9DMH35e-37A0A0A9DMH3_ARUDO; Uncharacterized protein
STRINGPavir.Ia03080.1.p4e-37(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84503041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67420.13e-37LOB domain-containing protein 37
Publications ? help Back to Top
  1. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]