PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462937052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family WOX
Protein Properties Length: 107aa    MW: 11640.1 Da    PI: 10.6157
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462937052genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox39.41e-1230682357
               SS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox 23 rypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               r+p+ae++e++A +l     ++ ++V++WFqN++a++++
  462937052 30 RTPNAEQIEQIAGRLrehgPIEAKNVFYWFQNHKARQRQ 68
               89***************999*****************97 PP

2Wus_type_Homeobox72.94.9e-2427692264
  Wus_type_Homeobox 22 sGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       +GlrtPn+e+i++i+ +L+e+G ie kNVfyWFQN+kaR+rqk
          462937052 27 HGLRTPNAEQIEQIAGRLREHGPIEAKNVFYWFQNHKARQRQK 69
                       69****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.8E-83076IPR009057Homeodomain-like
PfamPF000462.5E-103068IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.2E-53172IPR009057Homeodomain-like
PROSITE profilePS500718.7623269IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MEMPQGGGEA AAGQPDQGAG GGAGGAHGLR TPNAEQIEQI AGRLREHGPI EAKNVFYWFQ  60
NHKARQRQKE KQDSFAYFSR LLRRPPPLPV VFARPPGQAP PYPLGRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9540623e-62EU954062.1 Zea mays clone 1453569 homeobox domain containing protein mRNA, complete cds.
GenBankBT0370093e-62BT037009.1 Zea mays full-length cDNA clone ZM_BFb0151I01 mRNA, complete cds.
GenBankAM4902353e-62AM490235.1 Zea mays mRNA for putative wuschel homeobox protein (wox2A gene).
GenBankKJ7283843e-62KJ728384.1 Zea mays clone pUT6667 HB transcription factor (HB94) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306689.19e-27WUSCHEL-related homeobox 5
RefseqXP_009381843.13e-27PREDICTED: WUSCHEL-related homeobox 5
SwissprotA2WWU74e-26WOX5_ORYSI; WUSCHEL-related homeobox 5
SwissprotQ6X7K12e-26WOX2_ARATH; WUSCHEL-related homeobox 2
SwissprotQ8LR864e-26WOX5_ORYSJ; WUSCHEL-related homeobox 5
TrEMBLA0A0Q3S8614e-28A0A0Q3S861_SETIT; Uncharacterized protein (Fragment)
TrEMBLA8Y7V69e-27A8Y7V6_MAIZE; HB transcription factor
TrEMBLM0RLN12e-27M0RLN1_MUSAM; Uncharacterized protein
STRINGGRMZM2G108933_P013e-26(Zea mays)
STRINGGSMUA_Achr10P26570_0017e-27(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75093548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-22WUSCHEL related homeobox 2