PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462931397
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 701aa    MW: 78531.8 Da    PI: 6.7277
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462931397genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP113.99.1e-36277176
               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
        SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76
               +Cqv+gCead+ e+k yhrrh+vC  +++a++v+++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  462931397  2 RCQVPGCEADIRELKGYHRRHRVCLLCAHAAAVMLDGVQKRYCQQCGKFHILLDFDEDKRSCRRKLERHNKRRRRK 77
               6************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114129.624177IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-33179IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.103.4E-26264IPR004333Transcription factor, SBP-box
PfamPF031104.3E-27377IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MRCQVPGCEA DIRELKGYHR RHRVCLLCAH AAAVMLDGVQ KRYCQQCGKF HILLDFDEDK  60
RSCRRKLERH NKRRRRKPGS NGPFEKEMDE HFDLSADISG DGELREGNLP IENIEGTTSE  120
MLETVLSNKV LDRETPVGSE DVLSSPTCTE PTLQNEQSKS MVTFAASVEA CIGAKQENMK  180
LNSSPVHDTK SAYSSSCPTG RISFKLYDWN PAEFPRRLRH QIFEWLASMP VELEGYIRPG  240
CTILTVFIAM PQHMWDKLSD DTANLLRNLV NSPTSLLLGK GAFFIHTDNM IFQVLKDGAT  300
LMSSKIEVQA PRIHYVHPTW FEAGKPVELH LCGSSLDQPK LRSLVSFDGE YLKHDCFRLS  360
SLDAFDCVEK GDLTLDSQHE IFRICIKESR SDTHGPAFVE VENMFGLSNF VPILFGSKQL  420
CSELEKIQAV LCGSCKNNKV LCGSSCKNSD IVGEFPDASF DPCERQKIQS AAMSEFLVDI  480
GWLIRKPTPE EFKNLLSLTN IQRWVNMLKF LIQNDFFNVL EIIVKSVDNI VGSEIISNLE  540
RGRLEDHVTT FLGYVDHARS IIHHRAKHGE GTQLESRLVT DNFLKQPSLG TSVPLDNGNT  600
GPCGDNYLQS TSAACEEEVT VPLMTKDASH RQCCHPEINA RWLKPSLVIT FPGGATRTRL  660
LTSVVVAAVL CFTACVVLFH SHRVGMLAAP VKRYLSSDSA S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A3e-36282585squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15977KRSCRRKLERHNKRRRRKP
26375RRKLERHNKRRRR
37077NKRRRRKP
47176KRRRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462931397
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805456.10.0squamosa promoter-binding-like protein 9
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLA0A2T8KJS30.0A0A2T8KJS3_9POAL; Uncharacterized protein
STRINGSb09g020110.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.31e-134squamosa promoter binding protein-like 7
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]