PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462930693
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 873aa    MW: 98281.8 Da    PI: 7.2908
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462930693genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1231.3e-38124200278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                Cqv+gC+adls a++yh+rhkvCe+h+++ +v ++g+e+rfCqqCsrfh l+efDe+k+sCr+rLa+hn rrrk q+
  462930693 124 CQVDGCQADLSGARDYHKRHKVCEAHTRSRMVRIKGIEHRFCQQCSRFHLLQEFDEGKKSCRSRLAQHNGRRRKVQP 200
                **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-31117185IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.188121198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-36122202IPR004333Transcription factor, SBP-box
PfamPF031106.8E-30124197IPR004333Transcription factor, SBP-box
SuperFamilySSF484038.23E-6611756IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.206.4E-4612753IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 873 aa     Download sequence    Send to blast
MEAGFLWKGN GNRADAAGMS GGHNNRSVEW DLNDWSWNTN LFLATPSSAV PSERGGRDTI  60
RSQGEIDFGV VDKWRRVSPE DDSAECSNSI VANRENHGVV VQRARSSEEE RPRKGARSSS  120
SPSCQVDGCQ ADLSGARDYH KRHKVCEAHT RSRMVRIKGI EHRFCQQCSR FHLLQEFDEG  180
KKSCRSRLAQ HNGRRRKVQP QATVDGNSMI ENQSLSSTLF LLLKQLSGLE SGSSSERIDH  240
PNYLVNILKN LASIAGTQAY QEILKNANST SISSNAGNRI ANGFSMHDQT RPTLRVVTES  300
SPEEHPVKRR VQNFDLNDAC IEDVESRTDK IVFKLFGKEP KDFPVNLREQ ILNWLSHYPS  360
EMESYIRPGC VILTIYLRLP NWMWDEFDED PAPWIEKLIS MSNDGFWETE WVYARLQNWL  420
TLSCNGSLVL ASPWQPLIGD KHRRLCVTPI AVACSSTANF SVKGFNIVQP TTKLLCIFGE  480
KHLIQAETQM LLEDTTIQQD PQCLSFSCSF PSTSGRGLIE IEDYDQSSLS VPFVVTDEDI  540
CLEIRMLEHE LNMIPVCETL EHIDDLMASH NRALYFLQEF GWLLQRSHMR AMSDQARYCT  600
EGFPVGRFRW LLSFAVDHEW CAVVKKLLNI MFQGNLDVPS PDEFVQGLNL LFVAVNKRSK  660
PLVECLLRYT TPVDTGATTP VQFLFTPLMT GPPNITPLHT AATISDAAGV LDALTDDPQQ  720
MGIKVWKNAR DATGFTPEDY ARKRGFIPYI QMVQEKIDRK IPKAHISIAI ASAPSTTNIV  780
GKHNSRLNLA DKTTFDVEKS HSGIKQPPVS CNRCVQQLAY RPKTSRFLSN RPAVLSLVAI  840
AAVCVCVGLL MKSPPHIGCM RPFIWEHIKW GPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-28118197584squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462930693
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819590.10.0squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_025819591.10.0squamosa promoter-binding-like protein 1 isoform X1
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLA0A2S3HWL10.0A0A2S3HWL1_9POAL; Uncharacterized protein
TrEMBLA0A2T7DNE40.0A0A2T7DNE4_9POAL; Uncharacterized protein
STRINGGRMZM2G133646_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.11e-180squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang H,Zhai J,Mo J,Li D,Song F
    Overexpression of rice sphingosine-1-phoshpate lyase gene OsSPL1 in transgenic tobacco reduces salt and oxidative stress tolerance.
    J Integr Plant Biol, 2012. 54(9): p. 652-62
    [PMID:22889013]
  3. Zhang H, et al.
    Molecular characterization of rice sphingosine-1-phosphate lyase gene OsSPL1 and functional analysis of its role in disease resistance response.
    Plant Cell Rep., 2014. 33(10): p. 1745-56
    [PMID:25113543]