PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462928306
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 261aa    MW: 28764.3 Da    PI: 8.7263
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462928306genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.91.1e-411490278
               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
               C v+gC++dls+++eyhrrhkvCe+hsk+pvv+v g+eqrfCqqCsrfh+lsefDe+krsCr+rL++hn+rrrk+q+
  462928306 14 CAVDGCRSDLSRCREYHRRHKVCEAHSKTPVVVVGGQEQRFCQQCSRFHMLSEFDEGKRSCRKRLDGHNRRRRKPQH 90
               **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.4E-341075IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.2911188IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.5E-401393IPR004333Transcription factor, SBP-box
PfamPF031104.5E-311487IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
RRSRAAGRGV PEACAVDGCR SDLSRCREYH RRHKVCEAHS KTPVVVVGGQ EQRFCQQCSR  60
FHMLSEFDEG KRSCRKRLDG HNRRRRKPQH DIMNLGSFFP YGQVNQFAMY PQSASRFRLN  120
SDSMHVVDRQ QTFSISFSGT FKAPKQFPLS QDDGSMFNAP GPLNLLAEHN THTRTSSVCN  180
ALPGTLGPEC ALSLLSSSLH RPSPTAVEEQ VTSSLACIAA ASQDTTATAA AVAYASGVGH  240
HAFVPDALFE DPSQALPFPW Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-2714871184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17087KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462928306
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1336081e-48AC133608.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0085G12, complete sequence.
GenBankAC1355691e-48AC135569.6 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0018F17, complete sequence.
GenBankAP0149671e-48AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450775.11e-115putative squamosa promoter-binding-like protein 19 isoform X1
RefseqXP_021317606.11e-115putative squamosa promoter-binding-like protein 19 isoform X1
RefseqXP_021317607.11e-115putative squamosa promoter-binding-like protein 19 isoform X1
SwissprotQ2R3Y13e-92SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLA0A0A9D3R71e-117A0A0A9D3R7_ARUDO; Uncharacterized protein
STRINGSb05g017510.11e-114(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.17e-42SBP family protein