PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462927535
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 502aa    MW: 54924.6 Da    PI: 6.714
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462927535genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26094.11.6e-2913109197
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                aCaaC   rrkC++dCvlapyfp e+ +++a+v++++Ga+nv +ll++lp e+r +a+ +l++eA+a ++ Pvy +v+ i  lqq l+q++a+la+ 
  462927535  13 ACAACMDRRRKCEPDCVLAPYFPPEHWERYAAVRRVYGADNVANLLAELPLEQRAHAAGTLIFEARAAIKYPVYRCVSYIVVLQQMLKQKQAQLAAE 109
                7********************************************************************************************9875 PP

2DUF260109.91.9e-34192288197
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                aCaaCk+ r kC+++Cvlapyfp e+ ++fa+vhk +Gasnv+kll++lp+e+r +a+++lv+eAea  ++PvyG+v+ i +l+qql++++  la l
  462927535 192 ACAACKHRRAKCQPSCVLAPYFPPEHGAQFAAVHKAYGASNVSKLLAELPREDRARAVETLVFEAEAYNKNPVYGCVAYIIALSQQLHESHGYLAGL 288
                7**************************************************************************************9998877755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.73112113IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-2913108IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089121.969191292IPR004883Lateral organ boundaries, LOB
PfamPF031959.0E-34192285IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MSSGGSSSPP AAACAACMDR RRKCEPDCVL APYFPPEHWE RYAAVRRVYG ADNVANLLAE  60
LPLEQRAHAA GTLIFEARAA IKYPVYRCVS YIVVLQQMLK QKQAQLAAEM AEEVARVQHL  120
LAVQAQAEEE FARQQDERMR QALAAARERK NYPHQAQAGQ RWGTADAGTF VVQQQPQQPP  180
QPRARSMSEA PACAACKHRR AKCQPSCVLA PYFPPEHGAQ FAAVHKAYGA SNVSKLLAEL  240
PREDRARAVE TLVFEAEAYN KNPVYGCVAY IIALSQQLHE SHGYLAGLRG ELARSSGSAN  300
WAPPRRTRTA SASVQHLLAV QAQAEEEVER QQEERMRQAL ATARERIARE QQQQAAAMEI  360
DVTQPHLHQQ TVHQIANAQQ LSAAAGEVAR EQDMDLMMMM QQAAAYAQHG MPGNVSGATN  420
VAAFLPRGSS DAETFLLQHQ QQQPQMVNAH GFQTDASLPP PPLADLPRQQ QGDGGADDQF  480
SSDDLTAYFA IPGPNNPSDG SG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.14e-23LOB domain-containing protein 23