PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462927464
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 147aa    MW: 16044.2 Da    PI: 5.4691
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462927464genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260621.5e-1945945100
     DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lqqq++ql+ +lal+k+e
  462927464   4 CLQELPAQQRADAVSSLVYEANARMRDPVYGCVGAISYLQQQVSQLQMQLALAKAE 59 
                689*************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.695160IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-17457IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MDHCLQELPA QQRADAVSSL VYEANARMRD PVYGCVGAIS YLQQQVSQLQ MQLALAKAEI  60
LCVQMQQNDG QQGHPTAAPA SAKQQLQQQE MDGEACGNMF MQNGLMMNTL NSSAAHHQQH  120
LLGSFSSSGS TAMMLQEACL KKESLWA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1008524e-62FP100852.1 Phyllostachys edulis cDNA clone: bphyst013p01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441669.15e-55hypothetical protein SORBIDRAFT_08g000575, partial
RefseqXP_004978582.16e-55PREDICTED: LOB domain-containing protein 12-like
TrEMBLC5YQ286e-55C5YQ28_SORBI; Putative uncharacterized protein Sb08g000575 (Fragment)
TrEMBLK3ZJV97e-55K3ZJV9_SETIT; Uncharacterized protein
STRINGSb08g000575.12e-54(Sorghum bicolor)
STRINGSi026864m2e-54(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-24LBD family protein