PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462920556
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LFY
Protein Properties Length: 324aa    MW: 35455.5 Da    PI: 9.7656
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462920556genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY453.81.3e-138129281376
    FLO_LFY  81 mkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekk 180
                m+++eldd+m++l+ +fr+d+l+Ger+G++aa+raer r+++    + r     +  +t +da+sqe+ls+e+++     ++ +++g   ++l++++++ 
  462920556   1 MTERELDDMMAALAGLFRWDVLLGERFGLRAALRAERGRVMALG--AGRF----QTGSTCVDAVSQEVLSDERDAAASGGMADDETGRRLHQLAGKKQQA 94 
                9****************************************976..4554....345678************9977555444444444444444444333 PP

    FLO_LFY 181 seeekkkaskkkqkrkkkkelkse....ededeeeeed.edeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGe 275
                ++    +++ kk++rk++ +         ded   e+d ++++++g +g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr fLlqvq+iak  G+
  462920556  95 KKGAGGTRKGKKARRKRELR---PldvlGDEDGAGESDsTESSTGGGGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCRVFLLQVQTIAKMGGH 191
                33332222222333333332...123455555555544055556777888************************************************** PP

    FLO_LFY 276 kcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLr 375
                k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k+rgenvGawrqacy+plv+iaar+g+didavf+ahprLsiWYvPt+Lr
  462920556 192 KSPTKVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKARGENVGAWRQACYAPLVEIAARHGFDIDAVFAAHPRLSIWYVPTRLR 291
                **************************************************************************************************** PP

    FLO_LFY 376 q 376
                +
  462920556 292 R 292
                7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.2E-1501292IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MTERELDDMM AALAGLFRWD VLLGERFGLR AALRAERGRV MALGAGRFQT GSTCVDAVSQ  60
EVLSDERDAA ASGGMADDET GRRLHQLAGK KQQAKKGAGG TRKGKKARRK RELRPLDVLG  120
DEDGAGESDS TESSTGGGGG GERQREHPFV VTEPGEVARA KKNGLDYLFH LYEQCRVFLL  180
QVQTIAKMGG HKSPTKVTNQ VFRYAKKCGA SYINKPKMRH YVHCYALHCL DEEASNALRR  240
AYKARGENVG AWRQACYAPL VEIAARHGFD IDAVFAAHPR LSIWYVPTRL RRGAPAATHV  300
LSDLHRLLAG GLTLLVCLVD VVVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A4e-981403132175PROTEIN LEAFY
2vy2_A4e-981403132175PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462920556
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1798820.0AY179882.1 Zea mays cultivar A632 floricaula/leafy-like 1 (fl1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976675.11e-165probable transcription factor FL
SwissprotQ0JAI11e-153FL_ORYSJ; Probable transcription factor FL
TrEMBLK3YC121e-163K3YC12_SETIT; Uncharacterized protein
STRINGSi011756m1e-164(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.15e-96floral meristem identity control protein LEAFY (LFY)