PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462919771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 301aa    MW: 33972 Da    PI: 10.3594
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462919771genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF915.9e-291059251
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               ri+n++ rqvtfskRrng+lKKA+ELS+LCdaev +i+fsstg+lye+ss
  462919771 10 RIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVGLIVFSSTGRLYEFSS 59
               8***********************************************96 PP

2SRF-TF915.9e-2968117251
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                ri+n++ rqvtfskRrng+lKKA+ELS+LCdaev +i+fsstg+lye+ss
  462919771  68 RIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVGLIVFSSTGRLYEFSS 117
                8***********************************************96 PP

3K-box71.62.5e-24136229698
      K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKne.llleqieelqkkekelqeenkaLrkkl 98 
                g ++++++   +q+e+a L+++++nLq+++++l+Ge+L+ L +++Lq+Le++Le sl+++R++K + ll+++ieel kk   +++en++L +++
  462919771 136 GMNNATSEIMLWQREAASLRQQLHNLQESHKQLMGEELSGLGVRDLQSLENRLEMSLRNVRTRKVDyLLKSEIEELHKKGSLIHQENMELCRRV 229
                45577888899*****************************************************87256789*****************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.268161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-27260IPR002100Transcription factor, MADS-box
CDDcd002652.26E-38278No hitNo description
PRINTSPR004047.6E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003199.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.16559119IPR002100Transcription factor, MADS-box
CDDcd002655.15E-4161135No hitNo description
SMARTSM004323.3E-3561118IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-3261149IPR002100Transcription factor, MADS-box
PfamPF003199.6E-2668115IPR002100Transcription factor, MADS-box
PfamPF014862.3E-23143229IPR002487Transcription factor, K-box
PROSITE profilePS5129714.588144238IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELSILCD AEVGLIVFSS TGRLYEFSST  60
KGKIVIRRID NSTSRQVTFS KRRNGLLKKA KELSILCDAE VGLIVFSSTG RLYEFSSTNM  120
KTVIDRYAKA KEEQLGMNNA TSEIMLWQRE AASLRQQLHN LQESHKQLMG EELSGLGVRD  180
LQSLENRLEM SLRNVRTRKV DYLLKSEIEE LHKKGSLIHQ ENMELCRRVN IMSQQKLELH  240
KKIQASEQRG IVDANKSPST SYSFGVAKDA DVPANLELSQ SPHKEGGQRE AGAPELGLQL  300
P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-181132174MEF2C
5f28_B3e-181132174MEF2C
5f28_C3e-181132174MEF2C
5f28_D3e-181132174MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269|PubMed:23463009}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462919771
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5029041e-151AM502904.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM32A (WM32A gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025810861.11e-144MADS-box transcription factor 57-like
SwissprotQ6Z6W21e-133MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A2T8KXQ51e-145A0A2T8KXQ5_9POAL; Uncharacterized protein
STRINGPavir.Aa00445.1.p1e-145(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.13e-88AGAMOUS-like 16
Publications ? help Back to Top
  1. Guo S, et al.
    The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14.
    Nat Commun, 2013. 4: p. 1566
    [PMID:23463009]
  2. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  3. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]
  4. Wang H, et al.
    A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway.
    Plant Physiol., 2016. 170(4): p. 2365-77
    [PMID:26858364]