PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462918138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HRT-like
Protein Properties Length: 584aa    MW: 64707.3 Da    PI: 9.4966
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462918138genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like56.16.3e-18333363131
   HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                +CGv ledGs C ++Pv+gRKRC  HKG+Ri
  462918138 333 VCGVVLEDGSSCLEEPVQGRKRCNLHKGRRI 363
                7*****************************7 PP

2HRT-like55.96.9e-18543572130
   HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                +CG++++dGs+C++qPv+gRKRC+ HKG+R
  462918138 543 TCGARTSDGSPCMNQPVEGRKRCALHKGQR 572
                7****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004656.0E-6103205IPR000305GIY-YIG nuclease superfamily
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MPAATAAVRL KREDCPRTKH DSLFSPWKVR APLLFVPLLL LAICSCRHHE PAQCTTQFTV  60
LVGPSDWEDH AAGKEGVQRY HTRNLPDNFP GLYELGVAAA SDEGLRARRR DSRSVVVVYL  120
GQADNVRARL QQYGRSGSHL DTGNSAGKDE MNTLATGTGL FREVFARGYS VVFRCALMHN  180
KQEAEKTEAQ LLRVFDYAWN KLQNGACRRE EVLLKLERIS HRSSLLSRVR HMKQTIFGEK  240
AGIKIKGGGS VDIPSGIMRS MLPRVRTFVR FRPHLVNSEH GEGGTIDIPW NRTYQDKTCG  300
NRQAHGTRSE GYKVKRIDVA KRRTVPIQYS NSVCGVVLED GSSCLEEPVQ GRKRCNLHKG  360
RRIKGKPYCS TSSYPCQVEV SNTESVPQLS ENLNNSDQAQ ESELMSKNLA TALKEESRQS  420
SCFQAKEVKT GEAPTEHGTH ETAGVAGIYE QKSSHAESQS QEEQPSGRMW FELLKAQTKS  480
VSTHPLRGPR CQTRVADGVT AISRATKNDG TFGMVPIAGT TRCEKLSEVN VTSFSRSSGW  540
PCTCGARTSD GSPCMNQPVE GRKRCALHKG QRAPCPLIPL IEQT
Cis-element ? help Back to Top
SourceLink
PlantRegMap462918138
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802669.10.0protein EFFECTOR OF TRANSCRIPTION 2-like
TrEMBLA0A2S3H4330.0A0A2S3H433_9POAL; Uncharacterized protein
STRINGPavir.Ba01074.1.p0.0(Panicum virgatum)
STRINGSb02g037860.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79483443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.12e-49effector of transcription2