PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462917456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 271aa    MW: 30649.9 Da    PI: 9.5213
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462917456genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.61.2e-31958150
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
               krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+i+fss+gklye+ 
  462917456  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLYEFG 58
               79**********************************************95 PP

2K-box101.11.6e-33951821299
      K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                 +++s++qe+++Lk++ e+Lqr+qRh+lGedL++L++keLq+Le+qLe +l++ R+kK+++++eq++el++ke++l e nk+L++k++
  462917456  95 GESQSWHQEMSRLKAKFESLQRSQRHMLGEDLGPLNIKELQKLEKQLEYALSQARQKKTQIMMEQVDELRRKERQLGELNKQLKNKVA 182
                5689*********************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.529161IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.5E-31285IPR002100Transcription factor, MADS-box
CDDcd002651.51E-40287No hitNo description
PRINTSPR004048.8E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-333859IPR002100Transcription factor, MADS-box
PfamPF014864.2E-3096181IPR002487Transcription factor, K-box
PROSITE profilePS5129717.31897187IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048437Biological Processfloral organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIVFSS RGKLYEFGSA  60
GYGPTALLDR MVNKTLEKYH DCCYNAQGSN TSFGGESQSW HQEMSRLKAK FESLQRSQRH  120
MLGEDLGPLN IKELQKLEKQ LEYALSQARQ KKTQIMMEQV DELRRKERQL GELNKQLKNK  180
VALLEAEGCS SYKAAQTSWN PDATVSVVND RALSVPNHPG AATDCEPTLQ IGCQQFAAPE  240
AAAIPRSERE RETLKVPRIL EFKSQNSKDN V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-209918219102Developmental protein SEPALLATA 3
4ox0_B2e-209918219102Developmental protein SEPALLATA 3
4ox0_C2e-209918219102Developmental protein SEPALLATA 3
4ox0_D2e-209918219102Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Plays minor but redundant roles with MADS6 in floral development. {ECO:0000269|PubMed:19820190}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462917456
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0075056e-78AB007505.1 Triticum aestivum TaMADS#12 mRNA for MADS box transcription factor, complete cds.
GenBankAM5028736e-78AM502873.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM9B (WM9B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824169.11e-135MADS-box transcription factor 17-like
SwissprotQ7XUN21e-117MAD17_ORYSJ; MADS-box transcription factor 17
TrEMBLA0A2S3I9M91e-134A0A2S3I9M9_9POAL; Uncharacterized protein
STRINGSi010898m1e-133(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41873566
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-86AGAMOUS-like 6
Publications ? help Back to Top
  1. Duan Y, et al.
    Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.).
    Plant Mol. Biol., 2012. 80(4-5): p. 429-42
    [PMID:22933119]
  2. Hu Y, et al.
    Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development.
    Mol Plant, 2015. 8(9): p. 1366-84
    [PMID:25917758]
  3. Bai X, et al.
    Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
    Sci Rep, 2016. 6: p. 19022
    [PMID:26744119]