PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462917439
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 153aa    MW: 16432.8 Da    PI: 9.9436
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462917439genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS60.63.3e-191279216283
       GRAS 216 esvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                + vs +++rde+L+ v+ l P+vv++veqe+++n++++ +rf++a+ +y a++dslea+l+r+s er+
  462917439  12 QGVSPANPRDELLRRVRALGPQVVTLVEQELNTNTAPLYARFTDACAHYGAILDSLEATLGRDSAERA 79 
                55677889********************************************************9986 PP

2GRAS521.3e-1686153306374
       GRAS 306 rerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                +er+e ++kWr+r+++aGF+pv+ls  +a+q+ + +  ++  g+ ++ e+g l lgW +r ++++SaWr
  462917439  86 VERCEVFGKWRARFGMAGFRPVALSPGIADQVVARVGPTP-PGFAMKAENGVLRLGWVGRVVTVASAWR 153
                69**************************************.9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098511.171134IPR005202Transcription factor GRAS
PfamPF035141.1E-161279IPR005202Transcription factor GRAS
PfamPF035144.7E-1486153IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MEPGAPWRDP RQGVSPANPR DELLRRVRAL GPQVVTLVEQ ELNTNTAPLY ARFTDACAHY  60
GAILDSLEAT LGRDSAERAL GGGGPVERCE VFGKWRARFG MAGFRPVALS PGIADQVVAR  120
VGPTPPGFAM KAENGVLRLG WVGRVVTVAS AWR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.14e-71PREDICTED: scarecrow-like protein 8
SwissprotQ9FYR71e-44SCL8_ARATH; Scarecrow-like protein 8
TrEMBLB4FTE38e-75B4FTE3_MAIZE; Uncharacterized protein
TrEMBLC4IZS79e-74C4IZS7_MAIZE; Uncharacterized protein
STRINGGRMZM2G173429_P012e-71(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.18e-38SCARECROW-like 8