PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462917244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 256aa    MW: 26716.9 Da    PI: 5.2186
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462917244genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.81.9e-34101091100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +C aCk+ r kC+++Cvlapyfp  + ++fa+vhk +Gasnv+kll++lp+ +r +a+++lvyeAea  +dPvyG+v+ i +l+qql++++  la+++ e
  462917244  10 PCVACKHRRAKCEPSCVLAPYFPPGHGAQFAAVHKAYGASNVSKLLAELPRADRARAVETLVYEAEAYKEDPVYGCVAYIIALSQQLHESHGRLAAVRGE 109
                7****************************************************************************************99999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.0359110IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-3410106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MSSSSSEVTP CVACKHRRAK CEPSCVLAPY FPPGHGAQFA AVHKAYGASN VSKLLAELPR  60
ADRARAVETL VYEAEAYKED PVYGCVAYII ALSQQLHESH GRLAAVRGEL ARYVGAAAAS  120
QPLAIANAQQ LSAAAGEVAR EQDMDLMMMM QQAAAYAQHG MPGNMAGATN MAAFLPGGGG  180
SSNAGTFLVQ QQQPQQLQPQ TANAVGFQTD ASLPPPLAAL PRQQQDDGGA DDQFSSDDLT  240
AYFAIPGPNH PSDGSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704292.11e-39PREDICTED: LOB domain-containing protein 6
TrEMBLK4ADE81e-39K4ADE8_SETIT; Uncharacterized protein
STRINGSi036905m4e-39(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2943544
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.44e-34LBD family protein