PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462917019
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 354aa    MW: 36682.2 Da    PI: 6.5665
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462917019genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26060.54.7e-1966111146
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46 
                +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l
  462917019  66 PCAACKLLRRRCAQECPFAPYFSPHEPHKFAAVHKVFGASNVSKML 111
                7*******************************************98 PP

2DUF260113.61.3e-351142068100
     DUF260   8 lrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++pe er da+sslvyeA+ r+rdPvyG++g i+ lqqq+++l+ael+++++e
  462917019 114 LRRRCAQECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVPEAERADAASSLVYEANLRLRDPVYGCMGAISVLQQQVNSLEAELDAIRAE 206
                89*************************************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.49765207IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-1866111IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-35114204IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MQQALSDNSD CWASTRERLD EIGKKIKREP DAAGISALAA SASTAPAENP VPRRLGLGGA  60
LNTVTPCAAC KLLRRRCAQE CPFAPYFSPH EPHKFAAVHK VFGASNVSKM LLLLRRRCAQ  120
ECPFAPYFSP HEPHKFAAVH KVFGASNVSK MLLEVPEAER ADAASSLVYE ANLRLRDPVY  180
GCMGAISVLQ QQVNSLEAEL DAIRAEIFKH RYHQPGAGAS TGAAGLIDAA AQGRASFDVA  240
PGTPVHAGDV VSVVGAGQEA STVTGGATGA AGLVDDAAQA RASFDVAPGT PMHAGADVVS  300
VVGAAGQEAS TVAGAPGMPP SSAVYIAEAA EQPSSTTDHH YSSLNSSEHA AYFG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219191e-122AK121919.1 Oryza sativa Japonica Group cDNA clone:J033106D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970407.11e-97PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T51e-58LBD15_ARATH; LOB domain-containing protein 15
SwissprotQ9AT613e-58LBD13_ARATH; LOB domain-containing protein 13
TrEMBLK3XRN11e-102K3XRN1_SETIT; Uncharacterized protein
STRINGSi004575m1e-102(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.18e-58LOB domain-containing protein 15